SHOX Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: SHOX Antibody [NBP2-55181] - Staining of human cell line BJ shows localization to nucleoplasm & vesicles.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SHOX Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: AFVSKSFDQKSKDGNGGGGGGGGKKDSITYREVLESGLARSRELGTSDSSLQDITEGGGHCPVHLFKDHVDNDKEKLKEFGTARVAEGIYEC
Specificity
Specificity of human SHOX antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SHOX
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
SHOX Recombinant Protein Antigen (NBP2-55181PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for SHOX Antibody

  • GCFXX-linked
  • PHOGShort stature homeobox-containing protein
  • Pseudoautosomal homeobox-containing osteogenic protein
  • short stature homeobox protein
  • short stature homeobox
  • SHOXY

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB1228
Species: Hu
Applications: Flow, IHC, IP, CyTOF-ready
NB100-417
Species: Hu, Mu, Rt, Ca, Pl
Applications: WB, Simple Western, ChIP, ELISA, Flow, GS, IB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-61816
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC
AF1067
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, Neut
AF1067
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, Neut
NBP1-71770
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-49382
Species: Hu
Applications: IHC, IHC-P
NBP2-34234
Species: Hu
Applications: ICC/IF, IHC-Fr, IHC-P
NBP1-79075
Species: Hu
Applications: IHC, IHC-P
H00006474-M01
Species: Hu, Rt
Applications: WB, ELISA, RNAi
AF5535
Species: Hu
Applications: WB, Simple Western
NBP1-89953
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NB300-164
Species: Hu, Po, Ca, Rt(-)
Applications: WB, ICC/IF, IHC-Fr, IHC-P, IP
NB500-525
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP2-20460
Species: Hu, Mu, Rt
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP, ChIP
NBP2-20383
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-01223
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP2-02623
Species: Hu, Rt, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-55181
Species: Hu
Applications: ICC/IF

Publications for SHOX Antibody (NBP2-55181) (0)

There are no publications for SHOX Antibody (NBP2-55181).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SHOX Antibody (NBP2-55181) (0)

There are no reviews for SHOX Antibody (NBP2-55181). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for SHOX Antibody (NBP2-55181) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for SHOX Antibody (NBP2-55181)

Discover related pathways, diseases and genes to SHOX Antibody (NBP2-55181). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SHOX Antibody (NBP2-55181)

Discover more about diseases related to SHOX Antibody (NBP2-55181).
 

Pathways for SHOX Antibody (NBP2-55181)

View related products by pathway.

PTMs for SHOX Antibody (NBP2-55181)

Learn more about PTMs related to SHOX Antibody (NBP2-55181).

Blogs on SHOX

There are no specific blogs for SHOX, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SHOX Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SHOX