SHOX2 Antibody (1D1)

Western Blot: SHOX2 Antibody (1D1) [H00006474-M01] - SHOX2 monoclonal antibody (M01), clone 1D1 Analysis of SHOX2 expression in PC-12.

Western Blot: SHOX2 Antibody (1D1) [H00006474-M01] - Analysis of SHOX2 over-expressed 293 cell line, cotransfected with SHOX2 Validated Chimera RNAi ( Cat # H00006474-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with SHOX2 monoclonal antibody (M01), clone 1D1 (Cat # H00006474-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.

Western Blot: SHOX2 Antibody (1D1) [H00006474-M01] - Analysis of SHOX2 expression in transfected 293T cell line by SHOX2 monoclonal antibody (M01), clone 1D1.Lane 1: SHOX2 transfected lysate(37.6 KDa).Lane 2: Non-transfected lysate.

Sandwich ELISA: SHOX2 Antibody (1D1) [H00006474-M01] - Detection limit for recombinant GST tagged SHOX2 is 1 ng/ml as a capture antibody.

• Reactivity: Hu, Rt
• Applications: WB, ELISA, S-ELISA, KD
• Clone: 1D1
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated

SHOX2 Antibody (1D1) Summary

• Immunogen: SHOX2 (NP_006875, 117 a.a. ~ 204 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SPELKDRKDDAKGMEDEGQTKIKQRRSRTNFTLEQLNELERLFDETHYPDAFMREELSQRLGLSEARVQVWFQNRRAKCRKQENQLHK
• Localization: Nuclear
• Specificity: SHOX2 - short stature homeobox 2
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: SHOX2
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Knockdown Validated
  • Sandwich ELISA
  • Western Blot
• Application Notes: Antibody reactivity against cell lysate and recombinant protein for WB. It has been used for RNAi Validation and ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for SHOX2 Antibody (1D1)

• Homeobox protein Og12X
• OG12SHOX homologous gene on chromosome 3
• OG12Xshort stature homeobox protein 2
• short stature homeobox 2
• SHOTPaired-related homeobox protein SHOT

Background

This gene is a member of the homeo box family of genes that encode proteins containing a 60-amino acid residue motif that represents a DNA binding domain. Homeo box genes have been characterized extensively as transcriptional regulators involved in pattern formation in both invertebrate and vertebrate species. Several human genetic disorders are caused by aberrations in human homeo box genes. SHOX is a pseudoautosomal homeo box gene that is thought to be responsible for idiopathic short stature and implicated to play a role in the short stature phenotype of Turner syndrome patients. This gene is considered to be a candidate gene for Cornelia de Lange syndrome. Alternative splicing has been observed at this locus and two variants, each encoding a distinct isoform, have been identified.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SHOX2
• Entrez:
  • 6474(Human)
• OMIM:
  • 602504(Human)
• Uniprot:
  • NP_006875(Human)