Novus Biologicals products are now on bio-techne.com

SHOX2 Antibody (1D1)

Images

 
Western Blot: SHOX2 Antibody (1D1) [H00006474-M01] - SHOX2 monoclonal antibody (M01), clone 1D1 Analysis of SHOX2 expression in PC-12.
Western Blot: SHOX2 Antibody (1D1) [H00006474-M01] - Analysis of SHOX2 over-expressed 293 cell line, cotransfected with SHOX2 Validated Chimera RNAi ( Cat # H00006474-R01V ) (Lane 2) or non-transfected control (Lane 1). ...read more
Western Blot: SHOX2 Antibody (1D1) [H00006474-M01] - Analysis of SHOX2 expression in transfected 293T cell line by SHOX2 monoclonal antibody (M01), clone 1D1.Lane 1: SHOX2 transfected lysate(37.6 KDa).Lane 2: ...read more
Sandwich ELISA: SHOX2 Antibody (1D1) [H00006474-M01] - Detection limit for recombinant GST tagged SHOX2 is 1 ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, RtSpecies Glossary
Applications WB, ELISA, KD
Clone
1D1
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

SHOX2 Antibody (1D1) Summary

Description
Quality control test: Antibody Reactive Against Recombinant Protein.
Immunogen
SHOX2 (NP_006875, 117 a.a. ~ 204 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SPELKDRKDDAKGMEDEGQTKIKQRRSRTNFTLEQLNELERLFDETHYPDAFMREELSQRLGLSEARVQVWFQNRRAKCRKQENQLHK
Localization
Nuclear
Specificity
SHOX2 - short stature homeobox 2
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
SHOX2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Knockdown Validated
  • Sandwich ELISA
  • Western Blot
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has been used for RNAi Validation and ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for SHOX2 Antibody (1D1)

  • Homeobox protein Og12X
  • OG12SHOX homologous gene on chromosome 3
  • OG12Xshort stature homeobox protein 2
  • short stature homeobox 2
  • SHOTPaired-related homeobox protein SHOT

Background

This gene is a member of the homeo box family of genes that encode proteins containing a 60-amino acid residue motif that represents a DNA binding domain. Homeo box genes have been characterized extensively as transcriptional regulators involved in pattern formation in both invertebrate and vertebrate species. Several human genetic disorders are caused by aberrations in human homeo box genes. SHOX is a pseudoautosomal homeo box gene that is thought to be responsible for idiopathic short stature and implicated to play a role in the short stature phenotype of Turner syndrome patients. This gene is considered to be a candidate gene for Cornelia de Lange syndrome. Alternative splicing has been observed at this locus and two variants, each encoding a distinct isoform, have been identified.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP3-15753
Species: Hu, Mu, Rt
Applications: WB
NBP2-36528
Species: Hu, Mu
Applications: IP (-), WB
AF2444
Species: Hu
Applications: IHC, WB
AF7388
Species: Hu
Applications: IHC
314-BP
Species: Hu
Applications: BA, BA
NBP1-89946
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-89953
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
AF482
Species: Mu
Applications: IHC, WB
AF1494
Species: Hu, Mu, Rt
Applications: Block, IHC, Simple Western, WB
NBP1-84020
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB500-525
Species: Hu
Applications: ELISA, IHC, IHC-P, WB
NBP1-92334
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-94461
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP1-90010
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP3-17099
Species: Hu
Applications: IHC, IHC-P
NBP2-00714
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
AF1404
Species: Mu, Rt
Applications: Block, IHC, Simple Western, WB
345-FG
Species: Hu
Applications: BA
H00006474-M01
Species: Hu, Rt
Applications: WB, ELISA, KD

Publications for SHOX2 Antibody (H00006474-M01) (0)

There are no publications for SHOX2 Antibody (H00006474-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SHOX2 Antibody (H00006474-M01) (0)

There are no reviews for SHOX2 Antibody (H00006474-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SHOX2 Antibody (H00006474-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SHOX2 Antibody (1D1) and receive a gift card or discount.

Bioinformatics

Gene Symbol SHOX2
Entrez
OMIM
Uniprot