SHMT2 Antibody - BSA Free

Western Blot: SHMT2 Antibody [NBP3-35223] - Western blot analysis of various lysates using SHMT2 Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 3s.

Western Blot: SHMT2 Antibody [NBP3-35223] - Western Blot analysis of lysates from wild type (WT) and SHMT2 knockout (KO) HeLa cells using [KO Validated] SHMT2 Rabbit pAb at 1:400 dilution incubated overnight at 4C.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25 ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic KitExposure time: 30 s.

Western Blot: SHMT2 Antibody [NBP3-35223] - Western Blot analysis of various lysates using [KO Validated] SHMT2 Rabbit pAb at 1:400 dilution incubated overnight at 4C.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25 ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic KitExposure time: 30 s.

• Reactivity: Hu
• Applications: WB, ELISA
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

SHMT2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit SHMT2 Antibody - BSA Free (NBP3-35223) is a polyclonal antibody validated for use in WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 265-504 of human SHMT2 (NP_005403.2).
  
  Sequence:
  PSPFKHADIVTTTTHKTLRGARSGLIFYRKGVKAVDPKTGREIPYTFEDRINFAVFPSLQGGPHNHAIAAVAVALKQACTPMFREYSLQVLKNARAMADALLERGYSLVSGGTDNHLVLVDLRPKGLDGARAERVLELVSITANKNTCPGDRSAITPGGLRLGAPALTSRQFREDDFRRVVDFIDEGVNIGLEVKSKTAKLQDFKSFLLKDSETSQRLANLRQRVEQFARAFPMPGFDEH
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SHMT2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot 1:500 - 1:2000
• Theoretical MW: 56 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.09% Sodium Azide
• Purity: Affinity purified

Alternate Names for SHMT2 Antibody - BSA Free

• EC 2.1.2.1
• GLY A+
• GLYA
• glycine auxotroph A, human complement for hamster
• Glycine hydroxymethyltransferase
• serine aldolase
• serine hydroxymethylase
• serine hydroxymethyltransferase 2 (mitochondrial)
• serine hydroxymethyltransferase, mitochondrial
• Serine methylase
• SHMT
• SHMT2
• threonine aldolase

Background

The SHMT2 gene encodes the mitochondrial form of a pyridoxal phosphate-dependent enzyme that catalyzes the reversible reaction of serine and tetrahydrofolate to glycine and 5,10-methylene tetrahydrofolate. The encoded product is primarily responsible for glyci

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SHMT2