Orthogonal Strategies: Immunohistochemistry-Paraffin: SHMT2 Antibody [NBP1-80755] - Analysis in human liver and skeletal muscle tissues using NBP1-80755 antibody. Corresponding SHMT2 RNA-seq data are presented ...read more
Independent Antibodies: Immunohistochemistry-Paraffin: SHMT2 Antibody [NBP1-80755] - Staining of human duodenum, liver, lymph node and skeletal muscle using Anti-SHMT2 antibody NBP1-80755 (A) shows similar ...read more
Independent Antibodies: Western Blot: SHMT2 Antibody [NBP1-80755] - Analysis using Anti-SHMT2 antibody NBP1-80755 (A) shows similar pattern to independent antibody NBP1-80754 (B).
Immunocytochemistry/ Immunofluorescence: SHMT2 Antibody [NBP1-80755] - Staining of human cell line U-2 OS shows localization to mitochondria & microtubules. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: SHMT2 Antibody [NBP1-80755] - Staining of human skeletal muscle shows no positivity in myocytes as expected.
Western Blot: SHMT2 Antibody [NBP1-80755] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunohistochemistry-Paraffin: SHMT2 Antibody [NBP1-80755] - Staining of human liver shows moderate granular cytoplasmic positivity in hepatocytes.
Immunohistochemistry-Paraffin: SHMT2 Antibody [NBP1-80755] - Staining of human lymph node shows moderate granular cytoplasmic positivity in non-germinal center cells.
Immunohistochemistry-Paraffin: SHMT2 Antibody [NBP1-80755] - Staining of human duodenum shows moderate granular cytoplasmic positivity in glandular cells.
CQ sensitizes PDXs with low SHMT2 expression to 5-FU treatment.A Images of immunohistochemical staining for SHMT2, LC3, and p62 in CRC tissues from four selected patients (two with low SHMT2 expression and two with high ...read more
5-FU resistance is related to low SHMT2 expression and autophagy in CRC.A Expression of SHMT2 in three GEO datasets (GSE39582, GSE24551, and GSE21510). ***P < 0.001. B Representative images of immunohistochemical ...read more
Inhibition of autophagy induced by low SHMT2 expression sensitizes CRC cells to 5-FU treatment.A SHMT2 promoted apoptosis and inhibited autophagy in response to 5-FU treatment. Western blot analysis of lysates of HCT116 ...read more
Inhibition of autophagy induced by low SHMT2 expression sensitizes CRC cells to 5-FU treatment.A SHMT2 promoted apoptosis and inhibited autophagy in response to 5-FU treatment. Western blot analysis of lysates of HCT116 ...read more
SHMT2 interacts with cytosolic p53.A, B SHMT2 purified by Flag-IP was collected after in-gel digestion and used for LC-MS/MS analysis to search for the binding proteins of SHMT2. A Flag-SHMT2 was transfected into 293 T ...read more
This antibody was developed against Recombinant Protein corresponding to amino acids: GQLVRMAIRAQHSNAAQTQTGEANRGWTGQESLSDSDPEMWELLQREKDRQCRGLELIASENFCSRAALEAL
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SHMT2
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Reactivity reported in scientific literature (PMID: 24498411).
Packaging, Storage & Formulations
Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified
Alternate Names for SHMT2 Antibody - BSA Free
EC 2.1.2.1
GLY A+
GLYA
glycine auxotroph A, human complement for hamster
Glycine hydroxymethyltransferase
serine aldolase
serine hydroxymethylase
serine hydroxymethyltransferase 2 (mitochondrial)
serine hydroxymethyltransferase, mitochondrial
Serine methylase
SHMT
SHMT2
threonine aldolase
Background
The SHMT2 gene encodes the mitochondrial form of a pyridoxal phosphate-dependent enzyme that catalyzes the reversible reaction of serine and tetrahydrofolate to glycine and 5,10-methylene tetrahydrofolate. The encoded product is primarily responsible for glyci
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
=
÷
Review this Product
Be the first to review our SHMT2 Antibody - BSA Free and receive a gift card or discount.