SHMT2 Antibody

Images

 
Orthogonal Strategies: Immunohistochemistry-Paraffin: SHMT2 Antibody [NBP1-80755] - Analysis in human liver and skeletal muscle tissues using NBP1-80755 antibody. Corresponding SHMT2 RNA-seq data are presented ...read more
Independent Antibodies: Immunohistochemistry-Paraffin: SHMT2 Antibody [NBP1-80755] - Staining of human duodenum, liver, lymph node and skeletal muscle using Anti-SHMT2 antibody NBP1-80755 (A) shows similar ...read more
Independent Antibodies: Western Blot: SHMT2 Antibody [NBP1-80755] - Analysis using Anti-SHMT2 antibody NBP1-80755 (A) shows similar pattern to independent antibody NBP1-80754 (B).
Immunocytochemistry/ Immunofluorescence: SHMT2 Antibody [NBP1-80755] - Staining of human cell line U-2 OS shows localization to mitochondria & microtubules. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: SHMT2 Antibody [NBP1-80755] - Staining of human skeletal muscle shows no positivity in myocytes as expected.
Western Blot: SHMT2 Antibody [NBP1-80755] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunohistochemistry-Paraffin: SHMT2 Antibody [NBP1-80755] - Staining of human liver shows moderate granular cytoplasmic positivity in hepatocytes.
Immunohistochemistry-Paraffin: SHMT2 Antibody [NBP1-80755] - Staining of human lymph node shows moderate granular cytoplasmic positivity in non-germinal center cells.
Immunohistochemistry-Paraffin: SHMT2 Antibody [NBP1-80755] - Staining of human duodenum shows moderate granular cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SHMT2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: GQLVRMAIRAQHSNAAQTQTGEANRGWTGQESLSDSDPEMWELLQREKDRQCRGLELIASENFCSRAALEAL
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SHMT2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Western Blot 0.04 - 0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
SHMT2 Protein (NBP1-80755PEP)
Publications
Read Publications using NBP1-80755.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 24498411).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SHMT2 Antibody

  • EC 2.1.2.1
  • GLY A+
  • GLYA
  • glycine auxotroph A, human complement for hamster
  • Glycine hydroxymethyltransferase
  • serine aldolase
  • serine hydroxymethylase
  • serine hydroxymethyltransferase 2 (mitochondrial)
  • serine hydroxymethyltransferase, mitochondrial
  • Serine methylase
  • SHMT
  • SHMT2
  • threonine aldolase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-34390
Species: Hu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-P, WB
NBP1-85437
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-37607
Species: Hu, Rt
Applications: ELISA, IHC, IHC-P, WB
AF5724
Species: Hu, Mu, Rt
Applications: ICC, WB
NBP2-93574
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-87781
Species: Hu, Mu
Applications: IHC, IHC-P, WB
MAB6734
Species: Hu
Applications: IHC
H00001719-M01
Species: Hu, Mu, Rt, Ye
Applications: ELISA, ICC/IF, S-ELISA, WB
NB100-791
Species: Hu, Mu
Applications: IHC, IHC-P, PEP-ELISA, WB
NBP2-93732
Species: Hu, Mu(-)
Applications: WB
NBP1-87311
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
NBP2-01506
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-67656
Species: Hu, Mu, Rt, Ze
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
NBP2-02710
Species: Hu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP1-22439
Species: Ha, Hu, Mu, Rb, Rt
Applications: ICC/IF, IHC, IHC-P, IP, MiAr, WB
MAB1936
Species: Hu
Applications: IP, WB
NBP1-82612
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, KD, WB
NBP1-88527
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP1-83374
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, KD, WB
NBP1-80755
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for SHMT2 Antibody (NBP1-80755)(2)

Reviews for SHMT2 Antibody (NBP1-80755) (0)

There are no reviews for SHMT2 Antibody (NBP1-80755). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for SHMT2 Antibody (NBP1-80755) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SHMT2 Products

Bioinformatics Tool for SHMT2 Antibody (NBP1-80755)

Discover related pathways, diseases and genes to SHMT2 Antibody (NBP1-80755). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SHMT2 Antibody (NBP1-80755)

Discover more about diseases related to SHMT2 Antibody (NBP1-80755).
 

Pathways for SHMT2 Antibody (NBP1-80755)

View related products by pathway.

PTMs for SHMT2 Antibody (NBP1-80755)

Learn more about PTMs related to SHMT2 Antibody (NBP1-80755).

Blogs on SHMT2

There are no specific blogs for SHMT2, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SHMT2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SHMT2
Entrez
Uniprot