SHISA5 Antibody

Images

 
Immunohistochemistry-Paraffin: SHISA5 Antibody [NBP1-83190] - Staining of human kidney shows strong granular cytoplasmic positivity in cells in tubules.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SHISA5 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:EVCMASRGLSLFPESCPDFCCGTCDDQYCCSDVLKKFVWSEERCAVPEASVPASVEPVEQLGSALRFRPGYNDPMS
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SHISA5
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
SHISA5 Protein (NBP1-83190PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SHISA5 Antibody

  • protein shisa-5
  • Putative NF-kappa-B-activating protein 120
  • Scotin
  • SCOTINhShisa5
  • shisa homolog 5 (Xenopus laevis)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-24737
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ChIP, Flow, ICC/IF, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB100-56370
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-84161
Species: Hu
Applications: IHC, IHC-P
NBP2-19741
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF7117
Species: Hu, Mu
Applications: WB, IHC, ICC
NB100-65678
Species: Hu, Mu, Rt, Xp
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP1-28566
Species: Hu, Mu, Rt, Bv, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IP
NB100-1965
Species: Hu, Mu, Rt, Po, Av, Bv, Ch, Dr, GP, Rb, Sh, Xp, Ze
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NBP2-15278
Species: Hu
Applications: WB, IHC, IHC-P
NB200-112
Species: Hu, Mu, Rt, Ha, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, KO
NBP1-77198
Species: Hu, Mu
Applications: WB, ELISA, IHC, IHC-P, IF
MAB6000
Species: Hu
Applications: ICC/IF (-), WB, Flow, IHC, CyTOF-ready
NBP1-27972
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-24912
Species: Hu, Mu, Rt
Applications: WB, IHC-P
NBP1-30081
Species: Hu, Mu
Applications: WB, IP
NB120-13550
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-32665
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83190
Species: Hu
Applications: WB, IHC, IHC-P

Publications for SHISA5 Antibody (NBP1-83190) (0)

There are no publications for SHISA5 Antibody (NBP1-83190).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SHISA5 Antibody (NBP1-83190) (0)

There are no reviews for SHISA5 Antibody (NBP1-83190). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SHISA5 Antibody (NBP1-83190) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SHISA5 Products

Bioinformatics Tool for SHISA5 Antibody (NBP1-83190)

Discover related pathways, diseases and genes to SHISA5 Antibody (NBP1-83190). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SHISA5 Antibody (NBP1-83190)

Discover more about diseases related to SHISA5 Antibody (NBP1-83190).
 

Pathways for SHISA5 Antibody (NBP1-83190)

View related products by pathway.

Blogs on SHISA5

There are no specific blogs for SHISA5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SHISA5 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SHISA5