SHISA5 Antibody - BSA Free

Immunohistochemistry-Paraffin: SHISA5 Antibody [NBP1-83190] - Staining of human kidney shows strong granular cytoplasmic positivity in cells in tubules.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

SHISA5 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit SHISA5 Antibody - BSA Free (NBP1-83190) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: EVCMASRGLSLFPESCPDFCCGTCDDQYCCSDVLKKFVWSEERCAVPEASVPASVEPVEQLGSALRFRPGYNDPMS
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SHISA5
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  SHISA5 Protein (NBP1-83190PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for SHISA5 Antibody - BSA Free

• protein shisa-5
• Putative NF-kappa-B-activating protein 120
• Scotin
• SCOTINhShisa5
• shisa homolog 5 (Xenopus laevis)

Background

SHISA5 is a gene that codes for a protein with four isoforms with lengths of 240, 209, 137, and 118 amino acids and weights of approximately 26, 22, 15, and 13 kDa respectively. The protein that SHISA5 codes for is able to induce apoptosis in both caspase-dependent and p53/TP53-dependent apoptosis. Current research is being done on diseases and disorders related to this gene including carcinoma, pandas, neuroblastoma, and schizophrenia. SHISA5 has also been shown to have interactions with COPS5, TP53, WWOX, and ALG2 in pathways such as the p53 signaling pathway.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SHISA5