WDR1 Antibody

Images

 
Western Blot: WDR1 Antibody [NBP2-32665] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: WDR1 Antibody [NBP2-32665] - Immunofluorescent staining of human cell line A-431 shows localization to cytosol.
Immunohistochemistry: WDR1 Antibody [NBP2-32665] - Staining of human duodenum shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

WDR1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: EHLLKYEYQPFAGKIKDIAWTEDSKRIAVVGEGREKFGAVFLWDSGSSVGEITGHNKVINSVDIKQSRPYRLATGSDDNCAAFFEGPPFKFKFTI
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (98%), Rat (97%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
WDR1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:250
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:50-1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
WDR1 Protein (NBP2-32665PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for WDR1 Antibody

  • Actin-interacting protein 1
  • AIP1
  • NORI-1
  • WD repeat domain 1
  • WD repeat-containing protein 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-65678
Species: Hu, Mu, Rt, Xp
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-00527
Species: Hu, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-33177
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-19741
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF1970
Species: Hu
Applications: WB, Simple Western, IHC
AF7117
Species: Hu, Mu
Applications: WB, IHC, ICC
NB100-56077
Species: Hu
Applications: WB, IHC, IHC-P, IP
NB200-112
Species: Hu, Mu, Rt, Ha, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, KO
NBP1-85614
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-57242
Species: Hu
Applications: WB, ICC/IF
NBP1-30081
Species: Hu, Mu
Applications: WB, IP
NBP2-49557
Species: Hu
Applications: IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
H00010097-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NB100-127
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ChIP, Flow, ICC/IF, IHC, IHC-P, IP
AF1444
Species: Mu
Applications: WB, IHC
NBP2-37574
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP1-30955
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for WDR1 Antibody (NBP2-32665) (0)

There are no publications for WDR1 Antibody (NBP2-32665).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for WDR1 Antibody (NBP2-32665) (0)

There are no reviews for WDR1 Antibody (NBP2-32665). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for WDR1 Antibody (NBP2-32665) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional WDR1 Products

Bioinformatics Tool for WDR1 Antibody (NBP2-32665)

Discover related pathways, diseases and genes to WDR1 Antibody (NBP2-32665). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for WDR1 Antibody (NBP2-32665)

Discover more about diseases related to WDR1 Antibody (NBP2-32665).
 

Pathways for WDR1 Antibody (NBP2-32665)

View related products by pathway.

PTMs for WDR1 Antibody (NBP2-32665)

Learn more about PTMs related to WDR1 Antibody (NBP2-32665).
 

Research Areas for WDR1 Antibody (NBP2-32665)

Find related products by research area.

Blogs on WDR1

There are no specific blogs for WDR1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our WDR1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol WDR1