SHC4 Antibody


Immunocytochemistry/ Immunofluorescence: SHC4 Antibody [NBP2-56379] - Staining of human cell line SK-MEL-30 shows localization to cytosol.

Product Details

Reactivity HuSpecies Glossary
Applications ICC/IF

Order Details

SHC4 Antibody Summary

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: SQESPTPLCTLIPRMASMKLANPATLLSLKNFCLGTKEVPRLKLQESRDPGSSGPSS
Specificity of human SHC4 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
SHC4 Knockout HeLa Cell Lysate
Control Peptide
SHC4 Recombinant Protein Antigen (NBP2-56379PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Affinity purified

Alternate Names for SHC4 Antibody

  • hShcD
  • MGC34023
  • Rai-like protein
  • RaLPSH2 domain protein C4
  • SHC (Src homology 2 domain containing) family, member 4
  • SHCD
  • SHC-transforming protein 4
  • SHC-transforming protein D
  • Src homology 2 domain-containing-transforming protein C4


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Species: Hu
Applications: WB, Simple Western, IHC
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
Species: Hu
Applications: WB, ICC/IF
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, S-ELISA
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, KD
Species: Hu
Applications: WB, ICC
Species: Hu
Applications: WB, ELISA, Flow, IHC, IP, CyTOF-ready
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, IP, S-ELISA
Species: Hu
Applications: ICC/IF

Publications for SHC4 Antibody (NBP2-56379) (0)

There are no publications for SHC4 Antibody (NBP2-56379).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SHC4 Antibody (NBP2-56379) (0)

There are no reviews for SHC4 Antibody (NBP2-56379). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for SHC4 Antibody (NBP2-56379) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional SHC4 Products

Bioinformatics Tool for SHC4 Antibody (NBP2-56379)

Discover related pathways, diseases and genes to SHC4 Antibody (NBP2-56379). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SHC4 Antibody (NBP2-56379)

Discover more about diseases related to SHC4 Antibody (NBP2-56379).

Pathways for SHC4 Antibody (NBP2-56379)

View related products by pathway.

PTMs for SHC4 Antibody (NBP2-56379)

Learn more about PTMs related to SHC4 Antibody (NBP2-56379).

Research Areas for SHC4 Antibody (NBP2-56379)

Find related products by research area.

Blogs on SHC4

There are no specific blogs for SHC4, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our SHC4 Antibody and receive a gift card or discount.


Gene Symbol SHC4