SHC3 Antibody - BSA Free

Western Blot: SHC3 Antibody [NBP1-54810] - Titration: 0.2-1 ug/ml, Positive Control: HepG2 cell lysate.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

SHC3 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to SHC3(SHC (Src homology 2 domain containing) transforming protein 3) The peptide sequence was selected from the middle region of SHC3. Peptide sequence RLKPRPHAPDTAQFAGKEQTYYQGRHLGDTFGEDWQQTPLRQGSSDIYST. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SHC3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 64 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for SHC3 Antibody - BSA Free

• Neuronal Shc
• NSHCDKFZp686H1544
• N-Shcsrc homology 2 domain containing transforming protein C3
• Protein Rai
• RAI
• SH2 domain protein C3
• SHC (Src homology 2 domain containing) transforming protein 3
• SHCCFLJ45325
• SHC-transforming protein 3
• SHC-transforming protein C
• src homology 2 domain-containing transforming protein C3
• Src homology 2 domain-containing-transforming protein C3

Background

SHC3 is a signaling adapter that couples activated growth factor receptors to signaling pathway in neurons. SHC3 is involved in the signal transduction pathways of neurotrophin-activated Trk receptors in cortical neurons.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SHC3
• Uniprot:
  • Q92529(Human)