SHB Antibody

Images

 
Western Blot: SHB Antibody [NBP1-58355] - HepG2 cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity Hu, Mu, Rt, Bv, Ca, RbSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SHB Antibody Summary

Immunogen
Synthetic peptides corresponding to SHB(Src homology 2 domain containing adaptor protein B) The peptide sequence was selected from the N terminal of SHB. Peptide sequence ERPSQPPQAVPQASSAASASCGPATASCFSASSGSLPDDSGSTSDLIRAY.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SHB
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.2-1 ug/ml
Application Notes
This is a rabbit polyclonal antibody against SHB and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for SHB Antibody

  • bA3J10.2
  • RP11-3J10.8
  • SH2 domain-containing adapter protein B
  • SHB (Src homology 2 domain containing) adaptor protein B
  • SHB adaptor protein (a Src homology 2 protein)
  • SHB
  • Src homology 2 domain containing adaptor protein B

Background

SHB is the adapter protein which regulates several signal transduction cascades by linking activated receptors to downstream signaling components. SHB may play a role in angiogenesis by regulating FGFR1, VEGFR2 and PDGFR signaling. SHB may also play a role in T-cell antigen receptor/TCR signaling, interleukin-2 signaling, apoptosis and neuronal cells differentiation by mediating basic-FGF and NGF-induced signaling cascades. SHB may also regulate IRS1 and IRS2 signaling in insulin-producing cells.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-67327
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
AF887
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NBP1-47761
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB600-1287
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IP, CyTOF-ready
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P
NBP2-67360
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-37568
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-27104
Species: Hu, Mu, Pm
Applications: WB, IHC-P
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NB100-82001
Species: Hu, Mu, Rt, Po
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-00764
Species: Hu
Applications: WB, Flow, IHC, IHC-P
MAB37861
Species: Hu
Applications: WB, Simple Western, ICC
NBP1-58355
Species: Hu, Mu, Rt, Bv, Ca, Rb
Applications: WB

Publications for SHB Antibody (NBP1-58355) (0)

There are no publications for SHB Antibody (NBP1-58355).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SHB Antibody (NBP1-58355) (0)

There are no reviews for SHB Antibody (NBP1-58355). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SHB Antibody (NBP1-58355) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional SHB Products

Bioinformatics Tool for SHB Antibody (NBP1-58355)

Discover related pathways, diseases and genes to SHB Antibody (NBP1-58355). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SHB Antibody (NBP1-58355)

Discover more about diseases related to SHB Antibody (NBP1-58355).
 

Pathways for SHB Antibody (NBP1-58355)

View related products by pathway.

PTMs for SHB Antibody (NBP1-58355)

Learn more about PTMs related to SHB Antibody (NBP1-58355).

Blogs on SHB

There are no specific blogs for SHB, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SHB Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SHB
Uniprot