SHB Antibody (1M5C5)

Western Blot: SHB Antibody (1M5C5) [NBP3-33468] - Western blot analysis of various lysates, using SHB Rabbit mAb at 1:600 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilutionLysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 30s.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA
• Clone: 1M5C5
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

SHB Antibody (1M5C5) Summary

• Description: Novus Biologicals Rabbit SHB Antibody (1M5C5) (NBP3-33468) is a monoclonal antibody validated for use in WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 409-509 of human SHB (NP_003019.2).
  
  Sequence:
  IWYHGAISRGDAENLLRLCKECSYLVRNSQTSKHDYSLSLRSNQGFMHMKLAKTKEKYVLGQNSPPFDSVPEVIHYYTTRKLPIKGAEHLSLLYPVAVRTL
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: SHB
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA Recommended starting concentration is 1 ug/mL
  • Western Blot 1:500 - 1:1000
• Theoretical MW: 55 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for SHB Antibody (1M5C5)

• bA3J10.2
• RP11-3J10.8
• SH2 domain-containing adapter protein B
• SHB (Src homology 2 domain containing) adaptor protein B
• SHB adaptor protein (a Src homology 2 protein)
• SHB
• Src homology 2 domain containing adaptor protein B

Background

SHB is an adapter protein which regulates several signal transduction cascades by linking activated receptors to downstream signaling components. It may play a role in angiogenesis by regulating FGFR1, VEGFR2 and PDGFR signaling. It may also play a role in T-cell antigen receptor/TCR signaling, interleukin-2 signaling, apoptosis and neuronal cells differentiation by mediating basic-FGF and NGF-induced signaling cascades, and may also regulate IRS1 and IRS2 signaling in insulin-producing cells.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SHB