Home » SH3GL3 » SH3GL3 Antibodies » SH3GL3 Antibody

SH3GL3 Antibody

 (1 Publication)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Western Blot: SH3GL3 Antibody [NBP1-79630] - Mouse Brain Lysate 1ug/ml Gel Concentration 12%
Western Blot: SH3GL3 Antibody [NBP1-79630] - Mouse Brain Lysate 1ug/ml Gel Concentration 12%

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

SH3GL3 Antibody Summary

Immunogen
Synthetic peptide directed towards the middle region of human Sh3gl3The immunogen for this antibody is Sh3gl3. Peptide sequence IDPLQLLQDKDLKEIGHHLRKLEGRRLDYDYKKRRVGKIPEEEIRQAVEK.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SH3GL3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 1:1000
Application Notes
This is a rabbit polyclonal antibody against Sh3gl3 and was validated on Western blot.
Theoretical MW
38 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Publications
Read Publication using
NBP1-79630 in the following applications:

  • WB
    1 publication

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 30049645).

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for SH3GL3 Antibody

  • CNSA3
  • EEN-B2
  • endophilin-A3
  • SH3D2C
  • SH3-domain GRB2-like 3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Huntingtin
Antibody (JB89-34)
NBP2-75531
Western Blot: Huntingtin Antibody (JB89-34) [NBP2-75531] - Analysis of Huntingtin on A431 cell using anti-Huntingtin antibody at 1/500 dilution.
Immunohistochemistry-Paraffin: Huntingtin Antibody (JB89-34) [NBP2-75531] - Analysis of paraffin-embedded rat brain tissue using anti-Huntingtin antibody. Counter stained with hematoxylin.
Flow Cytometry: Huntingtin Antibody (JB89-34) [NBP2-75531] - Analysis of SH-SY-5Y cells with Huntingtin antibody at 1/100 dilution (red) compared with an unlabelled control (cells without incubation with primary antibody; black). Alexa Fluor 488-conjugated goat anti rabbit IgG was used as the secondary antibody.
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Endophilin
A1/SH3GL2 Antibody
AF8006
Western blot shows lysates of human brain stem tissue, human brain (hypothalamus) tissue, human brain (cerebellum) tissue, mouse brain (cerebellum) tissue, and rat brain tissue. PVDF membrane was probed with 1 µg/mL of Sheep Anti-Human Endophilin A1/SH3GL2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF8006) followed by HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). A specific band was detected for Endophilin A1/SH3GL2 at approximately 40 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Species: Hu, Mu, Rt
Applications: WB
EEN Antibody
(OTI2F5)
NBP2-02834
Western Blot: EEN Antibody (2F5) [NBP2-02834] Analysis of extracts (35ug) from 9 different cell lines by using anti-EEN monoclonal antibody.
Immunocytochemistry/Immunofluorescence: EEN Antibody (2F5) [NBP2-02834] - Staining of COS7 cells transiently transfected by pCMV6-ENTRY EEN.
Immunohistochemistry-Paraffin: EEN Antibody (2F5) [NBP2-02834] - Staining of paraffin-embedded Carcinoma of Human bladder tissue using anti-EEN mouse monoclonal antibody.
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P

SLC6A4/5-HTTLPR/Seroto ...
H00006532-D01P
Western Blot: SLC6A4/5-HTTLPR/Serotonin transporter Antibody [H00006532-D01P] - Analysis of SLC6A4 expression in mouse lung.
Flow Cytometry: SLC6A4/5-HTTLPR/Serotonin transporter Antibody [H00006532-D01P] - Fixed and permeabilized mouse mast cells were stained for 1 hour in 4C then stained with PE secondary and ran on FACS. Image from verified customer review.
Western Blot: SLC6A4/5-HTTLPR/Serotonin transporter Antibody [H00006532-D01P] - Analysis of SLC6A4 expression in transfected 293T cell line by SLC6A4 polyclonal antibody. Lane 1: SLC6A4 transfected lysate (70.30 KDa). Lane 2: Non-transfected lysate.
(1 Review)
(1 Publication)
Species: Hu, Mu
Applications: WB, Flow
PACE4/PCSK6
Antibody
H00005046-A01
Western Blot: PACE4 Antibody [H00005046-A01] - Analysis of PCSK6 expression in PC-12.
Western Blot: PACE4 Antibody [H00005046-A01] - Analysis of PCSK6 expression in Hela S3 NE (Cat # L013V3 ).
Western Blot: PACE4 Antibody [H00005046-A01] - Analysis of PCSK6 expression in NIH/3T3.
(1 Publication)
Species: Hu, Mu, Rt
Applications: WB, ELISA
Cadherin-11
Antibody (283416)
MAB1790
Cadherin‑11 was detected in immersion fixed paraffin-embedded sections of human placenta using Mouse Anti-Human Cadherin‑11 Monoclonal Antibody (Catalog # MAB1790) at 8 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Mouse HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS002) and counterstained with hematoxylin (blue). View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
Simple Western lane view shows lysates of PC‑3 human prostate cancer cell line, loaded at 0.2 mg/mL. Specific bands were detected for Cadherin‑11 at approximately 114 & 137 kDa (as indicated) using 20 µg/mL of Mouse Anti-Human Cadherin‑11 Monoclonal Antibody (Catalog # MAB1790). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system. Non-specific interaction with the 230 kDa Simple Western standard may be seen with this antibody.
Western blot shows lysates of PC‑3 human prostate cancer cell line. PVDF membrane was probed with 1 µg/mL of Mouse Anti-Human Cadherin‑11 Monoclonal Antibody (Catalog # MAB1790) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF007). A specific band was detected for Cadherin‑11 at approximately 110 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
(1 Review)
(5 Publications)
Species: Hu
Applications: WB, Simple Western, IHC
Alix Antibody
NBP1-90201
Western Blot: Alix Antibody [NBP1-90201] - Analysis in U-138MG cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-PDCD6IP antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.
Immunocytochemistry/Immunofluorescence: Alix Antibody [NBP1-90201] - Staining of human cell line U-2 OS shows localization to cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Alix Antibody [NBP1-90201] - Staining of human fallopian tube shows strong cytoplasmic positivity in glandular cells.
(1 Review)
(1 Publication)
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
EGFR Antibody
[Unconjugated]
AF1280
Western blot shows lysates of HeLa human cervical epithelial carcinoma cell line and MDA‑MB‑231 human breast cancer cell line. PVDF membrane was probed with 0.25 µg/mL of Goat Anti-Mouse EGFR Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1280) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF019). A specific band was detected for EGFR at approximately 170 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
EGFR was detected in immersion fixed frozen sections of mouse embryo (13 d.p.c.) using Goat Anti-Mouse EGFR Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1280) at 15 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). Specific staining was localized to developing muscle. View our protocol for Chromogenic IHC Staining of Frozen Tissue Sections.
Simple Western lane view shows lysates of HeLa human cervical epithelial carcinoma cell line and MDA‑MB‑231 human breast cancer cell line, loaded at 0.2 mg/mL. A specific band was detected for EGFR at approximately 180-191 kDa (as indicated) using 2.5 µg/mL of Goat Anti-Mouse EGFR Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1280) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the12-230 kDa separation system.
(1 Review)
(7 Publications)
Species: Mu
Applications: WB, Simple Western, IHC
Amphiphysin/AMPH
Antibody
NBP1-86033
Western Blot: Amphiphysin/AMPH Antibody [NBP1-86033] - Staining of human cerebral cortex, colon, kidney and tonsil using Anti-AMPH antibody NBP1-86033 (A) shows similar protein distribution across tissues to independent antibody NBP1-87561 (B).
Immunocytochemistry/Immunofluorescence: Amphiphysin/AMPH Antibody [NBP1-86033] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.
Immunohistochemistry-Paraffin: Amphiphysin/AMPH Antibody [NBP1-86033] - Staining of human colon.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
DYDC1 Antibody
NBP1-88779
Western Blot: DYDC1 Antibody [NBP1-88779] - Analysis in control (vector only transfected HEK293T lysate) and DYDC1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: DYDC1 Antibody [NBP1-88779] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferus ducts.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MBP Antibody (12)
NB600-717
Western Blot: MBP Antibody (12) [NB600-717] - Mouse Brain Tissue lysate probed with Rat anti MBP.
Immunocytochemistry/Immunofluorescence: MBP Antibody (12) [NB600-717] - Histological and mRNA analysis of the inflammatory cytokines in the vehicle- or etifoxine-treated mice at onset of clinical symptoms. At day 10 p.i., drug treated animals showed significant differences in MBP staining. Animals treated with etifoxine showed an increase in retention of percentage of MBP coverage (*p = 0.001). Image collected and cropped by CiteAb from the following publication (http://embomolmed.embopress.org/cgi/doi/10.1002/emmm.201202124), licensed under a CC-BY licence.
Immunohistochemistry-Frozen: MBP Antibody (12) [NB600-717] - Staining of MBP in mouse brain corpus callosum. Image from verified customer review.
(3 Reviews)
(16 Publications)
Species: Hu, Mu, Rt, Po, Bv, Ch, GP, Ma, Rb, Sh
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, RI
Ataxin-2 Antibody
NBP1-90063
Western Blot: Ataxin-2 Antibody [NBP1-90063] - Analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1. Remaining relative intensity is presented. Loading control: Anti-GAPDH.
Immunocytochemistry/Immunofluorescence: Ataxin-2 Antibody [NBP1-90063] - Staining of human cell line U-251 MG shows localization to cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Ataxin-2 Antibody [NBP1-90063] - Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts.
(2 Publications)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MBOAT2 Antibody
NBP1-82236
Western Blot: MBOAT2 Antibody [NBP1-82236] - Analysis in U-87MG ATCC cells transfected with control siRNA, target specific siRNA probe #1,. Remaining relative intensity is presented. Loading control: Anti-GAPDH.
Immunohistochemistry-Paraffin: MBOAT2 Antibody [NBP1-82236] - Staining of human colon shows strong cytoplasmic positivity in glandular cells.
Species: Hu
Applications: WB, IHC, IHC-P
Src [p Tyr419]
Antibody [Unconjugate
AF2685
Western blot shows lysates of MDA‑MB‑468 human breast cancer cell line and HepG2 human hepatocellular carcinoma cell line untreated (-) or treated (+) with 50 μM pervanadate (PV) for 10 minutes. PVDF membrane was probed with 1 µg/mL of Rabbit Anti-Human Phospho-Src (Y419) Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2685), followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog # HAF008). A specific band was detected for Phospho-Src (Y419) at approximately 56 - 61 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Src phosphorylated at Y419 was detected in immersion fixed paraffin-embedded sections of human liver array using Rabbit Anti-Human Phospho-Src (Y419) Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2685) at 10 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Rabbit HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS005) and counterstained with hematoxylin (blue). Lower panel shows a lack of labeling if primary antibodies are omitted and tissue is stained only with secondary antibody followed by incubation with detection reagents. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
Simple Western lane view shows lysates of MBA‑MB‑468 human breast cancer cell line untreated (-) or treated (+) with 50 µM Pervanadate (PV) for 10 minutes, loaded at 0.2 mg/mL. A specific band was detected for Phospho-Src (Y419) at approximately 64 kDa (as indicated) using 10 µg/mL of Rabbit Anti-Human Phospho-Src (Y419) Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2685). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
(1 Review)
(5 Publications)
Species: Hu
Applications: WB, Simple Western, IHC
Dynamin Antibody
(3G4B6)
NB110-60491
Western Blot: Dynamin Antibody (3G4B6) [NB110-60491] - Western blot analysis using anti-Dynamin monoclonal antibody against truncated Dynamin recombinant protein (1), SK-N-SH (2) and NIH3T3 (3) cell lysate.
Immunohistochemistry-Paraffin: Dynamin Antibody (3G4B6) [NB110-60491] - Immunohistochemical analysis of paraffin-embedded human Lymph tissue, glioma tissue and cerebellum tissue, showing membrane localization using Dynamin antibody with DAB staining.
Flow Cytometry: Dynamin Antibody (3G4B6) [NB110-60491] - Intracellular flow cytometric staining of 1 x 10^6 CHO (A) and HEK-293 (B) cells using Dynamin antibody (dark blue). Isotype control shown in orange. An antibody concentration of 1 ug/1x10^6 cells was used.
Species: Hu, Mu
Applications: WB, Simple Western, ELISA, Flow, IHC, IHC-Fr, IHC-P
Synaptojanin 1
Antibody
NBP1-87842
Immunocytochemistry/Immunofluorescence: Synaptojanin 1 Antibody [NBP1-87842] - Staining of human cell line U-251 MG shows localization to nucleoplasm, cytosol and centrosome. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Synaptojanin 1 Antibody [NBP1-87842] - Staining of human skeletal muscle shows no cytoplasmic positivity in myocytes as expected.
Immunohistochemistry-Paraffin: Synaptojanin 1 Antibody [NBP1-87842] - Analysis in human cerebral cortex and skeletal muscle tissues. Corresponding SYNJ1 RNA-seq data are presented for the same tissues.
(3 Publications)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
ETV2/ER71 Antibody
(827940)
MAB7740
Western blot shows lysates of bEnd.3 mouse endothelioma cell line and D3 mouse embryonic stem cell line. PVDF membrane was probed with 2 µg/mL of Rat Anti-Mouse ETV2/ER71 Monoclonal Antibody (Catalog # MAB7740) followed by HRP-conjugated Anti-Rat IgG Secondary Antibody (Catalog # HAF005). A specific band was detected for ETV2/ER71 at approximately 37 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Species: Mu
Applications: WB
MOG Antibody
H00004340-B01P
Western Blot: MOG Antibody [H00004340-B01P] - Analysis of MOG expression in rat brain.
Western Blot: MOG Antibody [H00004340-B01P] - Analysis of MOG expression in transfected 293T cell line by MOG polyclonal antibody. Lane 1: MOG transfected lysate(32.56 KDa). Lane 2: Non-transfected lysate.
(1 Review)
Species: Hu, Rt
Applications: WB
GRB2 Antibody
NB100-866
Western Blot: GRB2 Antibody [NB100-866] - (0.05ug/ml) staining of Mouse (A+C) and Rat (B+D) Brain (A+B) and Spleen (C+D) lysates (35ug total protein in RIPA buffer). Primary incubated for 1 hour. Detected by western blot using chemiluminescence.
Immunohistochemistry-Paraffin: GRB2 Antibody [NB100-866] - Negative Control showing staining of paraffin embedded Human Lymph Node, with no primary antibody.
Western Blot: GRB2 Antibody [NB100-866] - (0.03ug/ml) staining of Human (A) and Pig (B) Spleen lysates (35ug protein in RIPA buffer). Primary incubation was 1 hour. Detected by chemiluminescence.
(1 Publication)
Species: Hu, Mu, Rt, Po
Applications: WB, IHC, IHC-P, PEP-ELISA
SH3GL3 Antibody
NBP1-79630
SH3GL3 Antibody
Species: Hu, Mu
Applications: WB

Publications for SH3GL3 Antibody (NBP1-79630)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for SH3GL3 Antibody (NBP1-79630) (0)

There are no reviews for SH3GL3 Antibody (NBP1-79630). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SH3GL3 Antibody (NBP1-79630) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Learn about Custom Antibody Labeling

Additional SH3GL3 Products

Bioinformatics Tool for SH3GL3 Antibody (NBP1-79630)

Discover related pathways, diseases and genes to SH3GL3 Antibody (NBP1-79630). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SH3GL3 Antibody (NBP1-79630)

Discover more about diseases related to SH3GL3 Antibody (NBP1-79630).
 

Pathways for SH3GL3 Antibody (NBP1-79630)

View related products by pathway.

PTMs for SH3GL3 Antibody (NBP1-79630)

Learn more about PTMs related to SH3GL3 Antibody (NBP1-79630).

Blogs on SH3GL3

There are no specific blogs for SH3GL3, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SH3GL3 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol SH3GL3
Uniprot
COVID-19 update