SH3GL3 Antibody

Images

 
Western Blot: SH3GL3 Antibody [NBP1-79630] - Mouse Brain Lysate 1ug/ml Gel Concentration 12%

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SH3GL3 Antibody Summary

Immunogen
Synthetic peptide directed towards the middle region of human Sh3gl3The immunogen for this antibody is Sh3gl3. Peptide sequence IDPLQLLQDKDLKEIGHHLRKLEGRRLDYDYKKRRVGKIPEEEIRQAVEK.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SH3GL3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:1000
Application Notes
This is a rabbit polyclonal antibody against Sh3gl3 and was validated on Western blot.
Theoretical MW
38 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Publications
Read Publication using
NBP1-79630 in the following applications:

  • WB
    1 publication

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 30049645).

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for SH3GL3 Antibody

  • CNSA3
  • EEN-B2
  • endophilin-A3
  • SH3D2C
  • SH3-domain GRB2-like 3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-75531
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF8006
Species: Hu, Mu, Rt
Applications: WB
NBP2-02834
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
H00006532-D01P
Species: Hu, Mu
Applications: WB, Flow
H00005046-A01
Species: Hu, Mu, Rt
Applications: WB, ELISA
MAB1790
Species: Hu
Applications: WB, Simple Western, IHC
NBP1-90201
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
AF1280
Species: Mu
Applications: WB, Simple Western, IHC
NBP1-86033
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88779
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB600-717
Species: Hu, Mu, Rt, Po, Bv, Ch, GP, Ma, Rb, Sh
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, RI
NBP1-90063
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82236
Species: Hu
Applications: WB, IHC, IHC-P
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
NB110-60491
Species: Hu, Mu
Applications: WB, Simple Western, ELISA, Flow, IHC, IHC-Fr, IHC-P
NBP1-87842
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB7740
Species: Mu
Applications: WB
H00004340-B01P
Species: Hu, Rt
Applications: WB
NB100-866
Species: Hu, Mu, Rt, Po
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP1-79630
Species: Hu, Mu
Applications: WB

Publications for SH3GL3 Antibody (NBP1-79630)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for SH3GL3 Antibody (NBP1-79630) (0)

There are no reviews for SH3GL3 Antibody (NBP1-79630). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SH3GL3 Antibody (NBP1-79630) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional SH3GL3 Products

Bioinformatics Tool for SH3GL3 Antibody (NBP1-79630)

Discover related pathways, diseases and genes to SH3GL3 Antibody (NBP1-79630). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SH3GL3 Antibody (NBP1-79630)

Discover more about diseases related to SH3GL3 Antibody (NBP1-79630).
 

Pathways for SH3GL3 Antibody (NBP1-79630)

View related products by pathway.

PTMs for SH3GL3 Antibody (NBP1-79630)

Learn more about PTMs related to SH3GL3 Antibody (NBP1-79630).

Blogs on SH3GL3

There are no specific blogs for SH3GL3, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SH3GL3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SH3GL3
Uniprot
COVID-19 update