DYDC1 Antibody

Images

 
Western Blot: DYDC1 Antibody [NBP1-88779] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with ...read more
Immunocytochemistry/ Immunofluorescence: DYDC1 Antibody [NBP1-88779] - Staining of human cell line A-431 shows positivity in centrosome.
Immunohistochemistry-Paraffin: DYDC1 Antibody [NBP1-88779] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferus ducts.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

DYDC1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:ELEMQEKERQRIQELQRAQEQLGKEMRMNMENLVRNEDILHSEEATLDSGKTLAEISDRYGAPNLSRVEELDEPMFSDI
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DYDC1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
DYDC1 Protein (NBP1-88779PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for DYDC1 Antibody

  • BC019250 protein
  • DPY30 domain containing 1
  • DPY30 domain-containing protein 1
  • DPY30D1bA36D19.5
  • FLJ43920

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00011155-M06
Species: Hu
Applications: WB, ELISA, ICC/IF
NB600-1293
Species: Hu, Mu, Rt, Am, Bv, Ca, Ch, Tr
Applications: WB, ICC/IF, IHC, IHC-Fr
NBP1-90230
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84419
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-15079
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-41344
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, MiAr, PA
NBP1-98277
Species: Hu
Applications: WB
NBP1-82805
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-25162
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP1-55120
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
H00029107-M08
Species: Hu
Applications: WB, ELISA, ICC/IF
MAB6798
Species: Hu
Applications: WB, ICC
NBP1-82454
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85965
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF8107
Species: Hu
Applications: WB, IHC
NBP1-91848
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-86202
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-88536
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for DYDC1 Antibody (NBP1-88779) (0)

There are no publications for DYDC1 Antibody (NBP1-88779).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DYDC1 Antibody (NBP1-88779) (0)

There are no reviews for DYDC1 Antibody (NBP1-88779). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for DYDC1 Antibody (NBP1-88779) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional DYDC1 Products

Bioinformatics Tool for DYDC1 Antibody (NBP1-88779)

Discover related pathways, diseases and genes to DYDC1 Antibody (NBP1-88779). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DYDC1 Antibody (NBP1-88779)

Discover more about diseases related to DYDC1 Antibody (NBP1-88779).
 

Pathways for DYDC1 Antibody (NBP1-88779)

View related products by pathway.

Blogs on DYDC1

There are no specific blogs for DYDC1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DYDC1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DYDC1