SH3BP5 Antibody - BSA Free

Western Blot: SH3BP5 Antibody [NBP2-58311] - Western blot analysis in human cell line RT-4, human cell line U-251 MG, human plasma and human liver tissue.

Immunocytochemistry/Immunofluorescence: SH3BP5 Antibody [NBP2-58311] - Staining of human cell line U-2 OS shows localization to nucleoplasm & nuclear bodies.

• Reactivity: Hu
• Applications: WB, ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

SH3BP5 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: ELKAKYYVQLEQLKKTVDDLQAKLTLAKGEYKMALKNLEMISDEIHERRRSSAMGPRGCGVGAEGSSTSVEDLPGSKPEPDAISVASEAFEDDSCSNFVSE
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SH3BP5
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  SH3BP5 Recombinant Protein Antigen (NBP2-58311PEP)

Reactivity Notes

Mouse 89%, Rat 89%

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for SH3BP5 Antibody - BSA Free

• Sab
• SABSH3BP-5
• SH3 binding protein
• SH3 domain-binding protein 5
• SH3 domain-binding protein that preferentially associates with BTK
• SH3-domain binding protein 5 (BTK-associated)

Background

SH3BP5 (SH3 domain binding protein 5) binds to the SH3 domain of Bruton tyrosine kinase (BTK), a cytoplasmic tyrosine kinase crucial for the maturation of B-lineage cells. It inhibits the auto- and transphosphorylation activity of BTK and negatively regulates BTK-related cytoplasmic signaling in B-cells. SH3BP5 also interacts with JNK. The interaction with JNK occurs through a mitogen-activated protein KIM (kinase interaction motif) in a region distinct from the Bruton's tyrosine kinase-binding domain.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SH3BP5