SH3BP4 Antibody

Images

 
Immunohistochemistry: SH3BP4 Antibody [NBP1-86274] - Staining of human small intestine shows strong luminal membranous positivity in glandular cells.
Inhibition of T-cells: SH3BP4 Antibody [NBP1-86274] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10 Lane 2: Hep-G2

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P, INHIB T-cell
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SH3BP4 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:EGTLIDLSEGFSETSFNDIKVPSPSALLVDNPTPFGNAKEVIAIKDYCPTNFTTLKFSKGDHLYVLDTSGGEWWYAHNT
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (97%), Rat (97%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SH3BP4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Inhibition of T-cells
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
SH3BP4 Protein (NBP1-86274PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SH3BP4 Antibody

  • BOG25SH3 domain-binding protein 4
  • EHB10
  • EH-binding protein 10
  • SH3-domain binding protein 4
  • transferrin receptor trafficking protein
  • Transferrin receptor-trafficking protein
  • TTP

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-26612
Species: Hu
Applications: IP (-), WB
NBP2-02105
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF4245
Species: Hu
Applications: WB, IP
NB600-586
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF5415
Species: Hu
Applications: WB, IHC, ICC
NBP2-07799
Species: Hu
NBP2-47602
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
AF4779
Species: Hu
Applications: WB, IHC
NBP1-31851
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP2-20383
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-02623
Species: Hu, Rt, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-34390
Species: Hu
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP
NB100-1596
Species: Hu, Pm, Rb
Applications: WB, ICC/IF, IHC

Publications for SH3BP4 Antibody (NBP1-86274) (0)

There are no publications for SH3BP4 Antibody (NBP1-86274).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SH3BP4 Antibody (NBP1-86274) (0)

There are no reviews for SH3BP4 Antibody (NBP1-86274). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SH3BP4 Antibody (NBP1-86274) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SH3BP4 Products

Bioinformatics Tool for SH3BP4 Antibody (NBP1-86274)

Discover related pathways, diseases and genes to SH3BP4 Antibody (NBP1-86274). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SH3BP4 Antibody (NBP1-86274)

Discover more about diseases related to SH3BP4 Antibody (NBP1-86274).
 

Pathways for SH3BP4 Antibody (NBP1-86274)

View related products by pathway.

PTMs for SH3BP4 Antibody (NBP1-86274)

Learn more about PTMs related to SH3BP4 Antibody (NBP1-86274).
 

Research Areas for SH3BP4 Antibody (NBP1-86274)

Find related products by research area.

Blogs on SH3BP4

There are no specific blogs for SH3BP4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SH3BP4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SH3BP4