SH3BP4 Antibody


Immunohistochemistry: SH3BP4 Antibody [NBP1-86274] - Staining of human small intestine shows strong luminal membranous positivity in glandular cells.
Inhibition of T-cells: SH3BP4 Antibody [NBP1-86274] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10 Lane 2: Hep-G2

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P, INHIB T-cell

Order Details

SH3BP4 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: EGTLIDLSEGFSETSFNDIKVPSPSALLVDNPTPFGNAKEVIAIKDYCPTNFTTLKFSKGDHLYVLDTSGGEWWYAHNT
Specificity of human SH3BP4 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (97%), Rat (97%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Inhibition of T-cells
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
SH3BP4 Protein (NBP1-86274PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for SH3BP4 Antibody

  • BOG25SH3 domain-binding protein 4
  • EHB10
  • EH-binding protein 10
  • SH3-domain binding protein 4
  • transferrin receptor trafficking protein
  • Transferrin receptor-trafficking protein
  • TTP


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: IP (-), WB
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IP
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
Species: Hu
Applications: WB, ELISA, Flow, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Rt, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP
Species: Hu, Pm, Rb
Applications: WB, ICC/IF, IHC

Publications for SH3BP4 Antibody (NBP1-86274) (0)

There are no publications for SH3BP4 Antibody (NBP1-86274).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SH3BP4 Antibody (NBP1-86274) (0)

There are no reviews for SH3BP4 Antibody (NBP1-86274). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SH3BP4 Antibody (NBP1-86274) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional SH3BP4 Products

Bioinformatics Tool for SH3BP4 Antibody (NBP1-86274)

Discover related pathways, diseases and genes to SH3BP4 Antibody (NBP1-86274). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SH3BP4 Antibody (NBP1-86274)

Discover more about diseases related to SH3BP4 Antibody (NBP1-86274).

Pathways for SH3BP4 Antibody (NBP1-86274)

View related products by pathway.

PTMs for SH3BP4 Antibody (NBP1-86274)

Learn more about PTMs related to SH3BP4 Antibody (NBP1-86274).

Research Areas for SH3BP4 Antibody (NBP1-86274)

Find related products by research area.

Blogs on SH3BP4

There are no specific blogs for SH3BP4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our SH3BP4 Antibody and receive a gift card or discount.


Gene Symbol SH3BP4