SH2D2A Antibody - BSA Free

Immunohistochemistry-Paraffin: SH2D2A Antibody [NBP3-17766] - Staining of human thymus shows nuclear positivity in cortical and medullary cells.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

SH2D2A Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit SH2D2A Antibody - BSA Free (NBP3-17766) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: PSNIYVEVEDEGLPATLGHPVLRKSWSRPVPGGQNTGGSQLHSENSVIGQGPPLPHQPPPAWRHTLPHNLSRQVLQDRGQAWLPLGPPQ
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SH2D2A
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for SH2D2A Antibody - BSA Free

• F2771
• RIBP
• SCAP
• SH2 domain containing 2A
• SH2 domain protein 2A
• SH2 domain-containing adapter protein
• SH2D2A
• T cell specific adapter protein TSAd
• T cell-specific adapter protein
• T lymphocyte specific adaptor protein
• TSAd
• TSADSH2 domain-containing protein 2A
• VEGF receptor-associated protein
• VRAP

Background

Could be a T-cell-specific adapter protein involved in the control of T-cell activation. May play a role in the CD4-p56-LCK-dependent signal transduction pathway. Could also play an important role in normal and pathological angiogenesis. Could be an adapter protein that facilitates and regulates interaction of KDR with effector proteins important to endothelial cell survival and proliferation

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SH2D2A