INSIG-2 Antibody

Western Blot: INSIG-2 Antibody [NBP3-03000] - Analysis of extracts of Mouse kidney, using INSIG-2 antibody (NBP3-03000) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.

Immunohistochemistry-Paraffin: INSIG-2 Antibody [NBP3-03000] - Rat ovary using INSIG-2 Rabbit pAb (NBP3-03000) at dilution of 1:200 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Western Blot: INSIG-2 Antibody [NBP3-03000] - Analysis of extracts of various cell lines, using INSIG-2 antibody (NBP3-03000) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.

Immunohistochemistry-Paraffin: INSIG-2 Antibody [NBP3-03000] - Mouse brain using INSIG-2 Rabbit pAb (NBP3-03000) at dilution of 1:200 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC, IHC-P
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

INSIG-2 Antibody Summary

• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 50-150 of human INSIG-2 (NP_057217.2). QIQRNVTLFPPDVIASIFSSAWWVPPCCGTASAVIGLLYPCIDRHLGEPHKFKREWSSVMRCVAVFVGINHASAKVDFDNNIQLSLTLAALSIGLWWTFDR
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: INSIG2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500 - 1:2000
• Theoretical MW: 24 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS with 50% glycerol, pH7.3.
• Preservative: 0.05% Proclin 300
• Purity: Affinity purified

Alternate Names for INSIG-2 Antibody

• INSIG2 membrane protein
• INSIG-2
• insulin induced gene 2
• insulin induced protein 2
• insulin-induced gene 2 protein
• MGC26273

Background

The protein encoded by the INSIG2 gene is highly similar to the protein product encoded by gene INSIG1. Both INSIG1 proteinand this protein are endoplasmic reticulum proteins that block the processing of sterol regulatory element bindingproteins (SREBPs) by binding to SREBP cleavage-activating protein (SCAP), and thus prevent SCAP from escorting SREBPsto the Golgi. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: INSIG2