SH2D1A Antibody

Images

 
Western Blot: SH2D1A Antibody [H00004068-B01P] - Analysis of SH2D1A expression in transfected 293T cell line by SH2D1A polyclonal antibody. Lane 1: SH2D1A transfected lysate(14.08 KDa). Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

SH2D1A Antibody Summary

Immunogen
SH2D1A (NP_002342.1, 1 a.a. - 128 a.a.) full-length human protein. MDAVAVYHGKISRETGEKLLLATGLDGSYLLRDSESVPGVYCLCVLYHGYIYTYRVSQTETGSWSAETAPGVHKRYFRKIKNLISAFQKPDQGIVIPLQYPVEKKSSARSTQGTTGIREDPDVCLKAP
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
SH2D1A
Purity
Protein G purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
It has been used for WB.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein G purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for SH2D1A Antibody

  • DSHP
  • DSHPLYP
  • Duncan disease SH2-protein
  • EBVS
  • FLJ92177
  • IMD5
  • LYP
  • MTCP1
  • SAP/SH2D1A
  • SAPlymphoproliferative syndrome
  • SH2 domain containing 1A
  • SH2 domain-containing protein 1A
  • SH2D1A
  • signaling lymphocyte activation molecule-associated protein
  • Signaling lymphocytic activation molecule-associated protein
  • SLAM associated protein/SH2 domain protein 1A
  • SLAM-associated protein
  • T cell signal transduction molecule SAP
  • T-cell signal transduction molecule SAP
  • XLP
  • XLPD
  • XLPDFLJ18687
  • XLPSH2 domain protein 1A

Background

This gene encodes a protein that plays a major role in the bidirectional stimulation of T and B cells. This protein contains an SH2 domain and a short tail. It associates with the signaling lymphocyte-activation molecule, thereby acting as an inhibitor of this transmembrane protein by blocking the recruitment of the SH2-domain-containing signal-transduction molecule SHP-2 to its docking site. This protein can also bind to other related surface molecules that are expressed on activated T, B and NK cells, thereby modifying signal transduction pathways in these cells. Mutations in this gene cause lymphoproliferative syndrome X-linked type 1 or Duncan disease, a rare immunodeficiency characterized by extreme susceptibility to infection with Epstein-Barr virus, with symptoms including severe mononucleosis and malignant lymphoma. Multiple transcript variants encoding different isoforms have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB1642
Species: Hu
Applications: WB, Flow, CyTOF-ready
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
AF2558
Species: Hu, Mu
Applications: WB, Simple Western
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NB600-713
Species: Hu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-91031
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-91685
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF5739
Species: Hu, Mu, Rt
Applications: WB
AF1039
Species: Hu
Applications: WB, Flow, IHC, AgAct, CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta)
NBP2-13304
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
AF8221
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
NB500-517
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
AF4779
Species: Hu
Applications: WB, IHC
H00004068-B01P
Species: Hu
Applications: WB

Publications for SH2D1A Antibody (H00004068-B01P) (0)

There are no publications for SH2D1A Antibody (H00004068-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SH2D1A Antibody (H00004068-B01P) (0)

There are no reviews for SH2D1A Antibody (H00004068-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SH2D1A Antibody (H00004068-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SH2D1A Products

Bioinformatics Tool for SH2D1A Antibody (H00004068-B01P)

Discover related pathways, diseases and genes to SH2D1A Antibody (H00004068-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SH2D1A Antibody (H00004068-B01P)

Discover more about diseases related to SH2D1A Antibody (H00004068-B01P).
 

Pathways for SH2D1A Antibody (H00004068-B01P)

View related products by pathway.

PTMs for SH2D1A Antibody (H00004068-B01P)

Learn more about PTMs related to SH2D1A Antibody (H00004068-B01P).
 

Research Areas for SH2D1A Antibody (H00004068-B01P)

Find related products by research area.

Blogs on SH2D1A

There are no specific blogs for SH2D1A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SH2D1A Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SH2D1A
Entrez
Uniprot