SGLT3/SLC5A4 Antibody - BSA Free

Western Blot: SLC5A4 Antibody [NBP1-59886] - Jurkat cell lysate, concentration 1.25ug/ml.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 1 mg/ml

SGLT3/SLC5A4 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to SLC5A4(solute carrier family 5 (low affinity glucose cotransporter), member 4) (NP_055042). The peptide sequence was selected from the N terminal of SLC5A4. Peptide sequence MASTVSPSTIAETPEPPPLSDHIRNAADISVIVIYFLVVMAVGLWAMLKT The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SLC5A4
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 72 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 1 mg/ml
• Purity: Protein A purified

Alternate Names for SGLT3/SLC5A4 Antibody - BSA Free

• DJ90G24.4
• low affinity sodium-glucose cotransporter
• Na(+)/glucose cotransporter 3
• SAAT1
• SAAT1low affinity sodium glucose cotransporter
• SGLT2
• SGLT3
• SLC5A4
• sodium transporter
• Sodium/glucose cotransporter 3
• solute carrier family 5 (low affinity glucose cotransporter), member 4
• solute carrier family 5 (neutral amino acid transporters, system A), member 4
• Solute carrier family 5 member 4

Background

SLC5A4 belongs to the sodium:solute symporter family and is a sodium-dependent glucose transporter.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SLC5A4
• Entrez:
  • 6527(Human)
• Uniprot:
  • Q9NY91(Human)