SGLT3/SLC5A4 Antibody

Images

 
Western Blot: SLC5A4 Antibody [NBP1-59886] - Jurkat cell lysate, concentration 1.25ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SGLT3/SLC5A4 Antibody Summary

Immunogen
Synthetic peptides corresponding to SLC5A4(solute carrier family 5 (low affinity glucose cotransporter), member 4) (NP_055042). The peptide sequence was selected from the N terminal of SLC5A4. Peptide sequence MASTVSPSTIAETPEPPPLSDHIRNAADISVIVIYFLVVMAV
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SLC5A4
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.25 ug/ml
Theoretical MW
72 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Protein A purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for SGLT3/SLC5A4 Antibody

  • DJ90G24.4
  • low affinity sodium-glucose cotransporter
  • Na(+)/glucose cotransporter 3
  • SAAT1
  • SAAT1low affinity sodium glucose cotransporter
  • SGLT2
  • SGLT3
  • SLC5A4
  • sodium transporter
  • Sodium/glucose cotransporter 3
  • solute carrier family 5 (low affinity glucose cotransporter), member 4
  • solute carrier family 5 (neutral amino acid transporters, system A), member 4
  • Solute carrier family 5 member 4

Background

SLC5A4 belongs to the sodium:solute symporter family and is a sodium-dependent glucose transporter.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-20338
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-92384
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NB110-39113
Species: Hu, Mu, Rt
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Flow-IC
NBP2-22218
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82862
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB120-2941
Species: Hu, Mu, Rt, Bv, Pm
Applications: WB, IHC, IHC-P
NBP1-49533
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, Flow-IC
NBP1-69565
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-22683
Species: Hu
7270-IL/CF
Species: Hu
NBP1-33596
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-92005
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-47980
Species: Hu, Mk
Applications: WB, Flow, IHC, IHC-P, IP
NBP1-91944
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-13341
Species: Hu
Applications: IHC, IHC-P

Publications for SGLT3/SLC5A4 Antibody (NBP1-59886) (0)

There are no publications for SGLT3/SLC5A4 Antibody (NBP1-59886).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SGLT3/SLC5A4 Antibody (NBP1-59886) (0)

There are no reviews for SGLT3/SLC5A4 Antibody (NBP1-59886). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SGLT3/SLC5A4 Antibody (NBP1-59886) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for SGLT3/SLC5A4 Antibody (NBP1-59886)

Discover related pathways, diseases and genes to SGLT3/SLC5A4 Antibody (NBP1-59886). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SGLT3/SLC5A4 Antibody (NBP1-59886)

Discover more about diseases related to SGLT3/SLC5A4 Antibody (NBP1-59886).
 

Pathways for SGLT3/SLC5A4 Antibody (NBP1-59886)

View related products by pathway.

Blogs on SGLT3/SLC5A4

There are no specific blogs for SGLT3/SLC5A4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SGLT3/SLC5A4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC5A4
Entrez
Uniprot