SLC5A10 Antibody

Images

 
Immunohistochemistry-Paraffin: SLC5A10 Antibody [NBP2-13341] Staining of human salivary gland shows strong cytoplasmic, nuclear and membranous positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SLC5A10 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: PQSVQIENLTWWTLAQDVPLGTKAGDGQTP
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SLC5A10
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
SLC5A10 Protein (NBP2-13341PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SLC5A10 Antibody

  • FLJ25217
  • solute carrier family 5 (sodium/glucose cotransporter), member 10

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-20338
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-92384
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-47980
Species: Hu, Mk
Applications: WB, Flow, IHC, IHC-P, IP
NBP2-22218
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-59873
Species: Hu
Applications: WB
NBP2-33382
Species: Hu
Applications: IHC, IHC-P
NB120-2941
Species: Hu, Mu, Rt, Bv, Pm
Applications: WB, IHC, IHC-P
NBP2-32020
Species: Hu
Applications: IHC, IHC-P
NBP1-81821
Species: Hu
Applications: Simple Western, IHC, IHC-P
NBP1-84938
Species: Hu
Applications: IHC, IHC-P
NBP2-50465
Species: Hu
Applications: Flow, IHC, CyTOF-ready, Flow-CS
NBP1-47989
Species: Hu
Applications: WB, IHC, IHC-P
MAB4066
Species: Hu
Applications: WB, CyTOF-ready, ICFlow
NBP1-49533
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
MAB8508
Species: Hu, Mu, Rt
Applications: WB, IHC, CyTOF-ready, ICFlow
NB110-39113
Species: Hu, Mu, Rt
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
MAB1415
Species: Hu
Applications: Flow, CyTOF-ready, ICC
H00000265-M03
Species: Hu
Applications: WB, ELISA

Publications for SLC5A10 Antibody (NBP2-13341) (0)

There are no publications for SLC5A10 Antibody (NBP2-13341).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SLC5A10 Antibody (NBP2-13341) (0)

There are no reviews for SLC5A10 Antibody (NBP2-13341). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for SLC5A10 Antibody (NBP2-13341) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SLC5A10 Products

Bioinformatics Tool for SLC5A10 Antibody (NBP2-13341)

Discover related pathways, diseases and genes to SLC5A10 Antibody (NBP2-13341). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SLC5A10 Antibody (NBP2-13341)

Discover more about diseases related to SLC5A10 Antibody (NBP2-13341).
 

Pathways for SLC5A10 Antibody (NBP2-13341)

View related products by pathway.

Blogs on SLC5A10

There are no specific blogs for SLC5A10, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SLC5A10 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC5A10