sFRP-2 Antibody - BSA Free

Western Blot: SFRP2 Antibody [NBP1-56609] - Jurkat cell lysate, concentration 0.2-1 ug/ml.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

sFRP-2 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to SFRP2(secreted frizzled-related protein 2) The peptide sequence was selected from the middle region of SFRP2. Peptide sequence DRFPQDNDLCIPLASSDHLLPATEEAPKVCEACKNKNDDDNDIMETLCKN. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SFRP2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 37 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for sFRP-2 Antibody - BSA Free

• FRP2
• FRP-2secreted apoptosis related protein 1
• SARP-1
• SARP1sFRP-2
• SDF-5
• Secreted apoptosis-related protein 1
• secreted frizzled-related protein 2
• sFRP2
• sFRP-2

Background

SFRP2 is a member of the SFRP family that contains a cysteine-rich domain homologous to the putative Wnt-binding site of Frizzled proteins. SFRPs act as soluble modulators of Wnt signaling. Methylation of this gene is a potential marker for the presence of colorectal cancer.This gene encodes a member of the SFRP family that contains a cysteine-rich domain homologous to the putative Wnt-binding site of Frizzled proteins. SFRPs act as soluble modulators of Wnt signaling. Methylation of this gene is a potential marker for the presence of colorectal cancer. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for sFRP-2 Antibody (NBP1-56609)(1)

Publication using NBP1-56609

• Sari AR, Rufaut NW, Jones LN, Sinclair RD. Characterization of ovine dermal papilla cell aggregation. Int J Trichology. 2016-07-30 [PMID: 27625564]

Bioinformatics

• Gene Symbol: SFRP2
• Uniprot:
  • Q96HF1()