sFRP-4 Antibody

Images

 
Western Blot: sFRP-4 Antibody [NBP2-38632] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG. Lane 4: Human Plasma
Immunohistochemistry-Paraffin: sFRP-4 Antibody [NBP2-38632] - Staining of human endometrium using Anti-SFRP4 antibody NBP2-38632.
Immunohistochemistry-Paraffin: sFRP-4 Antibody [NBP2-38632] - Staining of human endometrium shows high expression.
Immunohistochemistry-Paraffin: sFRP-4 Antibody [NBP2-38632] - Staining of human testis shows low expression as expected.
Orthogonal Strategies: Immunohistochemistry-Paraffin: sFRP-4 Antibody [NBP2-38632] - Staining in human endometrium and testis tissues using anti-SFRP4 antibody. Corresponding SFRP4 RNA-seq data are presented for ...read more
Independent Antibodies: Immunohistochemistry-Paraffin: sFRP-4 Antibody [NBP2-38632] - Staining of human cerebral cortex, endometrium, kidney and testis using Anti-SFRP4 antibody NBP2-38632 (A) shows similar ...read more
Immunohistochemistry-Paraffin: sFRP-4 Antibody [NBP2-38632] - Staining of human cerebral cortex.
Immunohistochemistry-Paraffin: sFRP-4 Antibody [NBP2-38632] - Staining of human kidney.
Immunohistochemistry-Paraffin: sFRP-4 Antibody [NBP2-38632] - Staining of human testis using Anti-SFRP4 antibody NBP2-38632.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

sFRP-4 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: PTLATYLSKNYSYVIHAKIKAVQRSGCNEVTTVVDVKEIFKSSSPIPRTQVPLITNSSCQCPHILPHQDVLIMCYEWRSRMMLLENCLVEKWRDQLSKRSIQWEERLQEQRRTVQDKKKTAGRTSRSNPPKPKGKPPAPKPASPK
Specificity
Specificity of human sFRP-4 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (92%), Rat (92%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SFRP4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04 - 0.4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
sFRP-4 Protein (NBP2-38632PEP)
Reviewed Applications
Read 1 Review rated 4
using
NBP2-38632 in the following applications:

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for sFRP-4 Antibody

  • DDC-4
  • Frizzled protein, human endometrium
  • FRP-4
  • FRP-AP
  • frpHE
  • FRPHEMGC26498
  • FrzB2
  • secreted frizzled-related protein 4
  • secreted frizzled-related protein 4; secreted frizzled-related protein 4
  • sFRP4
  • sFRP-4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

1169-FR/CF
Species: Mu
2629-FG/CF
Species: Mu
NBP2-20331
Species: Hu
Applications: WB, IHC, IHC-P, MiAr
AF1329
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ChIP, CyTOF-ready, ICC, ICFlow
MAB134
Species: Hu
Applications: WB, IHC
AF1118
Species: Hu
Applications: WB, IHC
AF6150
Species: Mu
Applications: WB
AF1329
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ChIP, CyTOF-ready, ICC, ICFlow
7584-SF/CF
Species: Hu
NB100-91662
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-66987
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24695
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-38632
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for sFRP-4 Antibody (NBP2-38632) (0)

There are no publications for sFRP-4 Antibody (NBP2-38632).
By submitting your publication information earn gift cards and discounts for future purchases.

Review for sFRP-4 Antibody (NBP2-38632) (1) 41

Average Rating: 4
(Based on 1 review)
We have 1 review tested in 1 species: Human.

Reviews using NBP2-38632:
Filter by Applications
WB
(1)
All Applications
Filter by Species
Human
(1)
All Species
Images Ratings Applications Species Date Details
Western Blot sFRP-4 NBP2-38632
Enlarge
reviewed by:
Anonymous
WB Human 09/30/2019
View

Summary

ApplicationWestern Blot
Sample TestedWhole cell lysate
SpeciesHuman
LotR60484

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for sFRP-4 Antibody (NBP2-38632) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional sFRP-4 Products

Bioinformatics Tool for sFRP-4 Antibody (NBP2-38632)

Discover related pathways, diseases and genes to sFRP-4 Antibody (NBP2-38632). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for sFRP-4 Antibody (NBP2-38632)

Discover more about diseases related to sFRP-4 Antibody (NBP2-38632).
 

Pathways for sFRP-4 Antibody (NBP2-38632)

View related products by pathway.

PTMs for sFRP-4 Antibody (NBP2-38632)

Learn more about PTMs related to sFRP-4 Antibody (NBP2-38632).
 

Research Areas for sFRP-4 Antibody (NBP2-38632)

Find related products by research area.

Blogs on sFRP-4

There are no specific blogs for sFRP-4, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

4
5
0
4
1
3
0
2
0
1
0

Anonymous
09/30/2019
Application: WB
Species: Human

Bioinformatics

Gene Symbol SFRP4
Uniprot