SF-1/NR5A1/Steroidogenic Factor 1 Recombinant Protein Antigen Summary
Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SF-1/NR5A1/Steroidogenic Factor 1 Source: E.coli
Amino Acid Sequence: VPELILQLLQLEPDEDQVRARILGCLQEPTKSRPDQPAAFGLLCRMADQT Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
Source |
E. coli |
Protein/Peptide Type |
Recombinant Protein Antigen |
Gene |
NR5A1 |
Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
Dilutions |
- Antibody Competition 10-100 molar excess
|
Application Notes |
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-21418. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com |
Theoretical MW |
23 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
Storage |
Store at -20C. Avoid freeze-thaw cycles. |
Buffer |
PBS and 1M Urea, pH 7.4. |
Preservative |
No Preservative |
Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Alternate Names for SF-1/NR5A1/Steroidogenic Factor 1 Recombinant Protein Antigen
Background
Steroidogenic factor 1 (SF-1), a NR5 Fushi Tarazu-Like Receptor, has been shown to affect sexual differentiation, steroid metabolism, and neural development. SF-1 binds as a monomer and regulates all steroidogenic p450 genes, Mullerian inhibiting substance, the gonadotrophins, the ACTH receptor, oxytocin, nuclear receptor DAX-1, and several other genes. Four alternatively spliced isoforms of SF-1 have been isolated in mice, and they differ at the N and C termini but are identical in the DNA-binding domain. SF-1 expression has been documented in human brain, adrenal, spleen, liver, heart, ovary, testis, and placenta. ESTs have been isolated from human tissue libraries, including cancerous adrenal and normal lung and testis.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 3 months from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: WB
Species: Bv, Ca, Ch, ChHa, Eq, Gp, Hu, Mu, Ma-Op, Po, Pm, Rb, Rt, RM, Ze
Applications: IHC, IHC-P, KD, WB
Species: Hu, Mu, Pm, Rb, Rt
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, RM
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
Species: Hu
Applications: Flow, IHC, IHC-P, WB
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, IHC, IHC-P, WB
Species: Hu, Mu
Applications: IHC-P, WB
Species: Hu
Applications: ICC, Simple Western, WB
Species: Hu
Applications: ICC, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Pm
Applications: IHC, IHC-P, WB
Species: Ca, Hu, Mu, Pm, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IP, WB
Species: Hu
Applications: ICC, Simple Western, WB
Species: Hu
Applications: AC
Publications for SF-1/NR5A1/Steroidogenic Factor 1 Recombinant Protein Antigen (NBP3-21418PEP) (0)
There are no publications for SF-1/NR5A1/Steroidogenic Factor 1 Recombinant Protein Antigen (NBP3-21418PEP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for SF-1/NR5A1/Steroidogenic Factor 1 Recombinant Protein Antigen (NBP3-21418PEP) (0)
There are no reviews for SF-1/NR5A1/Steroidogenic Factor 1 Recombinant Protein Antigen (NBP3-21418PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for SF-1/NR5A1/Steroidogenic Factor 1 Recombinant Protein Antigen (NBP3-21418PEP) (0)
Additional SF-1/NR5A1/Steroidogenic Factor 1 Products
Research Areas for SF-1/NR5A1/Steroidogenic Factor 1 Recombinant Protein Antigen (NBP3-21418PEP)
Find related products by research area.
|
Blogs on SF-1/NR5A1/Steroidogenic Factor 1