SF-1/NR5A1/Steroidogenic Factor 1 Recombinant Protein Antigen

Images

 
There are currently no images for SF-1/NR5A1/Steroidogenic Factor 1 Recombinant Protein Antigen (NBP3-21418PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

SF-1/NR5A1/Steroidogenic Factor 1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SF-1/NR5A1/Steroidogenic Factor 1

Source: E.coli

Amino Acid Sequence: VPELILQLLQLEPDEDQVRARILGCLQEPTKSRPDQPAAFGLLCRMADQT

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
NR5A1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-21418. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com
Theoretical MW
23 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for SF-1/NR5A1/Steroidogenic Factor 1 Recombinant Protein Antigen

  • AD4BP
  • AD4BPSTF-1
  • Adrenal 4-binding protein
  • ELP
  • FTZ1adrenal 4 binding protein
  • FTZF1
  • FTZF1nuclear receptor AdBP4
  • Fushi tarazu factor homolog 1
  • NR5A1
  • Nuclear receptor subfamily 5 group A member 1
  • nuclear receptor subfamily 5, group A, member 1
  • SF1
  • SF-1
  • SF-1POF7
  • SF1steroidogenic factor 1
  • Steroid hormone receptor Ad4BP
  • steroidogenic factor-1

Background

Steroidogenic factor 1 (SF-1), a NR5 Fushi Tarazu-Like Receptor, has been shown to affect sexual differentiation, steroid metabolism, and neural development. SF-1 binds as a monomer and regulates all steroidogenic p450 genes, Mullerian inhibiting substance, the gonadotrophins, the ACTH receptor, oxytocin, nuclear receptor DAX-1, and several other genes. Four alternatively spliced isoforms of SF-1 have been isolated in mice, and they differ at the N and C termini but are identical in the DNA-binding domain. SF-1 expression has been documented in human brain, adrenal, spleen, liver, heart, ovary, testis, and placenta. ESTs have been isolated from human tissue libraries, including cancerous adrenal and normal lung and testis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

PP-H7431-00
Species: Hu
Applications: WB
NBP2-27196
Species: Bv, Ca, Ch, ChHa, Eq, Gp, Hu, Mu, Ma-Op, Po, Pm, Rb, Rt, RM, Ze
Applications: IHC,  IHC-P, KD, WB
NB100-1596
Species: Hu, Mu, Pm, Rb, Rt
Applications: ICC/IF, IHC,  IHC-P, Simple Western, WB
NBP1-33485
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-85368
Species: Hu, RM
Applications: ICC/IF, IHC,  IHC-P, WB
NB100-1533
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC,  IHC-P, PEP-ELISA, WB
NBP2-01151
Species: Hu
Applications: Flow, IHC,  IHC-P, WB
NBP2-37463
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, IHC,  IHC-P, WB
NBP2-38770
Species: Hu, Mu
Applications:  IHC-P, WB
AF3075
Species: Hu
Applications: ICC, Simple Western, WB
AF2818
Species: Hu
Applications: ICC, WB
NBP2-13891
Species: Hu
Applications: IHC,  IHC-P
NB110-60011
Species: Hu
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, IP, Simple Western, WB
NBP3-35187
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
NBP1-30475
Species: Hu, Mu
Applications: IHC,  IHC-P, IP, WB
NBP2-49223
Species: Hu
Applications: IHC,  IHC-P
NB100-56603
Species: Ca, Hu, Mu, Pm, Rt
Applications: IHC,  IHC-P, WB
PP-H8132-00
Species: Hu
Applications: IHC, IP, WB
MAB8930
Species: Hu
Applications: ICC, Simple Western, WB
NBP3-21418PEP
Species: Hu
Applications: AC

Publications for SF-1/NR5A1/Steroidogenic Factor 1 Recombinant Protein Antigen (NBP3-21418PEP) (0)

There are no publications for SF-1/NR5A1/Steroidogenic Factor 1 Recombinant Protein Antigen (NBP3-21418PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SF-1/NR5A1/Steroidogenic Factor 1 Recombinant Protein Antigen (NBP3-21418PEP) (0)

There are no reviews for SF-1/NR5A1/Steroidogenic Factor 1 Recombinant Protein Antigen (NBP3-21418PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for SF-1/NR5A1/Steroidogenic Factor 1 Recombinant Protein Antigen (NBP3-21418PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SF-1/NR5A1/Steroidogenic Factor 1 Products

Research Areas for SF-1/NR5A1/Steroidogenic Factor 1 Recombinant Protein Antigen (NBP3-21418PEP)

Find related products by research area.

Blogs on SF-1/NR5A1/Steroidogenic Factor 1

There are no specific blogs for SF-1/NR5A1/Steroidogenic Factor 1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our SF-1/NR5A1/Steroidogenic Factor 1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol NR5A1