SERPINB1 Antibody - BSA Free

Western Blot: SERPINB1 Antibody [NBP2-49056] - Analysis using Anti-SERPINB1 antibody NBP2-49056 (A) shows similar pattern to independent antibody NBP1-89072 (B).

Immunohistochemistry-Paraffin: SERPINB1 Antibody [NBP2-49056] - Staining of human kidney.

Western Blot: SERPINB1 Antibody [NBP2-49056] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4Lane 3: Human cell line U-251 MGLane 4: Human plasmaLane 5: Human Liver tissueLane 6: Human Tonsil tissue

Immunohistochemistry: SERPINB1 Antibody [NBP2-49056] - Staining of human bone marrow shows moderate cytoplasmic positivity in hematopoietic cells.

Immunohistochemistry-Paraffin: SERPINB1 Antibody [NBP2-49056] - Staining of human cerebral cortex shows low expression as expected.

Immunohistochemistry-Paraffin: SERPINB1 Antibody [NBP2-49056] - Staining of human esophagus shows high expression.

Immunohistochemistry-Paraffin: SERPINB1 Antibody [NBP2-49056] - Staining in human esophagus and cerebral cortex tissues using anti-SERPINB1 antibody. Corresponding SERPINB1 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: SERPINB1 Antibody [NBP2-49056] - Staining of human bone marrow, kidney, liver and testis using Anti-SERPINB1 antibody NBP2-49056 (A) shows similar protein distribution across tissues to independent antibody NBP1-89072 (B).

Immunohistochemistry-Paraffin: SERPINB1 Antibody [NBP2-49056] - Staining of human bone marrow.

Immunohistochemistry-Paraffin: SERPINB1 Antibody [NBP2-49056] - Staining of human testis.

Immunohistochemistry-Paraffin: SERPINB1 Antibody [NBP2-49056] - Staining of human liver.

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

SERPINB1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit SERPINB1 Antibody - BSA Free (NBP2-49056) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: YNFLPEFLVSTQKTYGADLASVDFQHASEDARKTINQWVKGQTEGKIPELLASGMVDNMTKLVLVN
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SERPINB1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  SERPINB1 Recombinant Protein Antigen (NBP2-49056PEP)

Reactivity Notes

Mouse (88%), Rat (89%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for SERPINB1 Antibody - BSA Free

• EILEI
• ELANH2MNEI
• elastase
• leukocyte elastase inhibitor
• Monocyte/neutrophil elastase inhibitor
• Peptidase inhibitor 2
• PI-2
• PI2M/NEI
• protease inhibitor 2 (elastase), monocyte/neutrophil derived
• serine (or cysteine) proteinase inhibitor, clade B (ovalbumin), member 1
• Serpin B1
• serpin peptidase inhibitor, clade B (ovalbumin), member 1

Background

Regulates the activity of the neutrophil proteases elastase, cathepsin G, proteinase-3, chymase,chymotrypsin, and kallikrein-3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SERPINB1