Serpin F2/alpha 2-Antiplasmin Antibody

Images

 
Immunohistochemistry-Paraffin: Alpha 2 Antiplasmin Antibody [NBP1-90305] - Staining of human liver shows moderate cytoplasmic and nuclear positivity in hepatocytes.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Serpin F2/alpha 2-Antiplasmin Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:VPVEMMQARTYPLRWFLLEQPEIQVAHFPFKNNMSFVVLVPTHFEWNVSQVLANLSWDTLHPPLVWERPTKVRLPKLYLKHQMDLVATLSQLGLQELFQAPDLRGISEQSLVVSGVQHQSTL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SERPINF2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Serpin F2/alpha 2-Antiplasmin Protein (NBP1-90305PEP)
Publications
Read Publication using NBP1-90305.

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (80%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Serpin F2/alpha 2-Antiplasmin Antibody

  • AAPclade F (alpha-2 antiplasmin
  • alpha 2-Antiplasmin
  • Alpha-2-AP
  • Alpha-2-PI
  • Alpha-2-plasmin inhibitor
  • pigment epithelium derived factor), member 2
  • Serpin F2
  • serpin peptidase inhibitor, clade F (alpha-2 antiplasmin, pigment epitheliumderived factor), member 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-930
Species: Hu, Ba
Applications: WB, ELISA
AF1267
Species: Hu
Applications: WB, IP, Neut
NBP2-20648
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P
NBP1-19773
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
AF1310
Species: Hu
Applications: WB, IHC, IP
NBP1-58268
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-33855
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-07799
Species: Hu
NBP2-48990
Species: Hu
Applications: ICC/IF, IHC
46420002
Species: Hu
Applications: WB, ELISA
NBP1-31555
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-92164
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-81029
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB6240
Species: Hu
Applications: WB, IHC
NBP2-24614
Species: Hu, Mu, Rt, Op, Pm
Applications: WB
NBP2-24763
Species: Hu, Pm
Applications: WB, IHC-P
NB100-55268
Species: Hu
Applications: WB, IP
NBP1-87343
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NBP1-77933
Species: Hu, Mu, Rt, Bv, Ca, Ch, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-90305
Species: Hu
Applications: IHC, IHC-P

Publications for Serpin F2/alpha 2-Antiplasmin Antibody (NBP1-90305)(1)

Reviews for Serpin F2/alpha 2-Antiplasmin Antibody (NBP1-90305) (0)

There are no reviews for Serpin F2/alpha 2-Antiplasmin Antibody (NBP1-90305). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Serpin F2/alpha 2-Antiplasmin Antibody (NBP1-90305) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Serpin F2/alpha 2-Antiplasmin Products

Bioinformatics Tool for Serpin F2/alpha 2-Antiplasmin Antibody (NBP1-90305)

Discover related pathways, diseases and genes to Serpin F2/alpha 2-Antiplasmin Antibody (NBP1-90305). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Serpin F2/alpha 2-Antiplasmin Antibody (NBP1-90305)

Discover more about diseases related to Serpin F2/alpha 2-Antiplasmin Antibody (NBP1-90305).
 

Pathways for Serpin F2/alpha 2-Antiplasmin Antibody (NBP1-90305)

View related products by pathway.

Blogs on Serpin F2/alpha 2-Antiplasmin

There are no specific blogs for Serpin F2/alpha 2-Antiplasmin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Serpin F2/alpha 2-Antiplasmin Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SERPINF2
Entrez