Serpin F2/alpha 2-Antiplasmin Antibody - BSA Free

Staining of human kidney shows moderate cytoplasmic positivity in cells in tubules.

Staining of human liver shows strong cytoplasmic positivity in hepatocytes.

Staining of human skeletal muscle shows moderate cytoplasmic positivity in myocytes.

Staining of human placenta shows strong cytoplasmic positivity in trophoblastic cells.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Serpin F2/alpha 2-Antiplasmin Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Serpin F2/alpha 2-Antiplasmin Antibody - BSA Free (NBP1-90305) is a polyclonal antibody validated for use in IHC. Anti-Serpin F2/alpha 2-Antiplasmin Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: VPVEMMQARTYPLRWFLLEQPEIQVAHFPFKNNMSFVVLVPTHFEWNVSQVLANLSWDTLHPPLVWERPTKVRLPKLYLKHQMDLVATLSQLGLQELFQAPDLRGISEQSLVVSGVQHQSTL
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SERPINF2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  Serpin F2/alpha 2-Antiplasmin Protein (NBP1-90305PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (80%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Serpin F2/alpha 2-Antiplasmin Antibody - BSA Free

• AAPclade F (alpha-2 antiplasmin
• alpha 2-Antiplasmin
• Alpha-2-AP
• Alpha-2-PI
• Alpha-2-plasmin inhibitor
• pigment epithelium derived factor), member 2
• Serpin F2
• serpin peptidase inhibitor, clade F (alpha-2 antiplasmin, pigment epitheliumderived factor), member 2

Background

Identification in human milk of complexes of matriptase with ATIII, A1AT, or A2AP, provides evidence that the proteolytic activity of matriptase, from cells that express no or low levels of HAI-1, may be controlled by secreted serpins. Sequencing analysis revealed the presence of two alpha2-PI gene variations, both in the second half of exon 10: a frameshift mutation and a G to A transition at nucleotide 11337 in codon 407. Observational study of gene-disease association. (HuGE Navigator). Thrombin activatable fibrinolysis inhibitor and alpha(2)-antiplasmin are not markers for recanalization in patients with ischemic stroke treated with recombinant tissue-type plasminogen activator. Fibrinolysis is amplified by converting alpha-antiplasmin from a plasmin inhibitor to a substrate. Hydroxyethyl starch (HES) dilution enhances fibrinolysis by diminishing alpha2-antiplasmin-plasmin interactions. the Arg6Trp polymorphism may play a significant role in governing the long-term deposition/removal of intravascular fibrin. TAFIa, PAI-1 and alpha-antiplasmin: complementary roles in regulating lysis of thrombi and plasma clots. Alpha2-antiplasmin has an important role in acute pulmonary embolism. Multiple Lys residues within alpha 2-antiplasmin contribute, perhaps in a zipper-like fashion, to its binding to the in-tandem, multikringle array that configures the plasmin heavy chain. alpha2-antiplasmin induction inhibits E-cadherin processing mediated by the plasminogen activator/plasmin system, leading to suppression of progression of oral squamous cell carcinoma via upregulation of cell-cell adhesion

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Serpin F2/alpha 2-Antiplasmin Antibody (NBP1-90305)(1)

Publication using NBP1-90305

• Kato BS, Nicholson G, Neiman M et al. Variance decomposition of protein profiles from antibody arrays using a longitudinal twin model. Proteome Sci 2011-11-17 [PMID: 22093360]

Bioinformatics

• Gene Symbol: SERPINF2