Semenogelin II Antibody

Images

 
Western Blot: Semenogelin II Antibody [NBP1-92377] - Analysis in control (vector only transfected HEK293T lysate) and SEMG2 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian ...read more
Immunohistochemistry-Paraffin: Semenogelin II Antibody [NBP1-92377] - Staining of human liver.
Immunohistochemistry-Paraffin: Semenogelin II Antibody [NBP1-92377] - Staining of human seminal vesicle shows high expression.
Immunohistochemistry-Paraffin: Semenogelin II Antibody [NBP1-92377] - Staining of human skeletal muscle shows low expression as expected.
Orthogonal Strategies: Immunohistochemistry-Paraffin: Semenogelin II Antibody [NBP1-92377] - Staining in human seminal vesicle and skeletal muscle tissues using anti-SEMG2 antibody. Corresponding SEMG2 RNA-seq ...read more
Independent Antibodies: Immunohistochemistry-Paraffin: Semenogelin II Antibody [NBP1-92377] - Staining of human colon, kidney, liver and seminal vesicle using Anti-SEMG2 antibody NBP1-92377 (A) shows similar ...read more
Immunohistochemistry-Paraffin: Semenogelin II Antibody [NBP1-92377] - Staining of human kidney.
Immunohistochemistry-Paraffin: Semenogelin II Antibody [NBP1-92377] - Staining of human colon.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Semenogelin II Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: GRYKQESSESHNIVITEHEVAQDDHLTQQYNEDRNP
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SEMG2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:2500 - 1:5000
  • Immunohistochemistry-Paraffin 1:2500 - 1:5000
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Semenogelin II Protein (NBP1-92377PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Semenogelin II Antibody

  • semenogelin IISGIISemenogelin 2
  • semenogelin-2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-15895
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB120-15160
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB100-56163
Species: Ma, Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
DKK300
Species: Hu
Applications: ELISA
NBP1-80782
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-89825
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-38770
Species: Hu, Mu
Applications: IHC-P, WB
NBP1-80782
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NB100-1533
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
AF1445
Species: Mu, Rt
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, Neut, WB
NB600-534
Species: Hu, Mu, Po, V-Vi
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, RIA, WB
NBP1-30475
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
AF6018
Species: Hu, Mu
Applications: ICC, IP, WB
NBP2-52432
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, IHC, IHC-P, WB
NBP2-29421
Species: Bv, Gt, Hu, Po, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
H00005311-M01
Species: Hu
Applications: ELISA, ICC/IF, PLA, S-ELISA, WB
NBP2-14924
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
AF1067
Species: Hu, Mu, Rt
Applications: ELISA, IHC, Neut, WB
NBP2-34260
Species: Bv, Hu, Mu, Po, Rb
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-78898
Species: Hu
Applications: PAGE

Publications for Semenogelin II Antibody (NBP1-92377) (0)

There are no publications for Semenogelin II Antibody (NBP1-92377).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Semenogelin II Antibody (NBP1-92377) (0)

There are no reviews for Semenogelin II Antibody (NBP1-92377). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Semenogelin II Antibody (NBP1-92377) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Semenogelin II Products

Bioinformatics Tool for Semenogelin II Antibody (NBP1-92377)

Discover related pathways, diseases and genes to Semenogelin II Antibody (NBP1-92377). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Semenogelin II Antibody (NBP1-92377)

Discover more about diseases related to Semenogelin II Antibody (NBP1-92377).
 

Pathways for Semenogelin II Antibody (NBP1-92377)

View related products by pathway.

Blogs on Semenogelin II

There are no specific blogs for Semenogelin II, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Semenogelin II Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SEMG2