Secretogranin 3 Antibody

Western Blot: Secretogranin 3 Antibody [NBP1-89825] - Analysis in control (vector only transfected HEK293T lysate) and SCG3 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).

Immunohistochemistry-Paraffin: Secretogranin 3 Antibody [NBP1-89825] - Staining in human cerebral cortex and placenta tissues using anti-SCG3 antibody. Corresponding SCG3 RNA-seq data are presented for the same tissues.

Western Blot: Secretogranin 3 Antibody [NBP1-89825] - Analysis in human cell line SH-SY5Y.

Immunohistochemistry-Paraffin: Secretogranin 3 Antibody [NBP1-89825] - Staining of human hippocampus shows cytoplasmic positivity in neurons.

Immunohistochemistry-Paraffin: Secretogranin 3 Antibody [NBP1-89825] - Staining of human cerebral cortex shows high expression.

Immunohistochemistry-Paraffin: Secretogranin 3 Antibody [NBP1-89825] - Staining of human placenta shows low expression as expected.

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

Secretogranin 3 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: LDGTPLTAEDIVHKIAARIYEENDRAVFDKIVSKLLNLGLITESQAHTLEDEVAEVLQKLISKEANNYEEDPNKPTSWTENQAGKIPEKVTPMAAIQDGLAKGE
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SCG3
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  Secretogranin 3 Protein (NBP1-89825PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (87%), Rat (88%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Secretogranin 3 Antibody

• SCG3
• Secretogranin III
• secretogranin IIIFLJ90833
• Secretogranin-3
• SGIII

Background

Secretogranin 3 is encoded by this gene is a member of the chromogranin/secretogranin family of neuroendocrine secretory proteins. Granins may serve as precursors for biologically active peptides. Some granins have been shown to function as helper proteins in sorting and proteolytic processing of prohormones; however, the function of this protein is unknown. [provided by RefSeq]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Secretogranin 3 Antibody (NBP1-89825)(2)

Publications using NBP1-89825

• Wang Y, Ji N, Wang J et al. SCG3 Protein Expression in Glioma Associates With less Malignancy and Favorable Clinical Outcomes Pathology and Oncology Research 2021-02-26 [PMID: 34257545]
• Leja J, Essaghir A, Essand M et al. Novel markers for enterochromaffin cells and gastrointestinal neuroendocrine carcinomas. Mod Pathol 2009-02-01 [PMID: 18953328]

Bioinformatics

• Gene Symbol: SCG3