Secretogranin 3 Antibody - BSA Free

Analysis in human cerebral cortex and cervix, uterine tissues using NBP1-89825 antibody. Corresponding SCG3 RNA-seq data are presented for the same tissues.

Staining of human cerebral cortex shows strong cytoplasmic positivity in neurons and moderate cytoplasmic positivity in neuropil.

Staining of human cervix, uterine shows no positivity in squamous epithelial cells as expected.

Staining of human liver shows no positivity in hepatocytes as expected.

Staining of human pancreas shows strong cytoplasmic positivity in endocrine glandular cells.

Analysis in human cell line SH-SY5Y.

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Secretogranin 3 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Secretogranin 3 Antibody - BSA Free (NBP1-89825) is a polyclonal antibody validated for use in IHC and WB. Anti-Secretogranin 3 Antibody: Cited in 2 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: LDGTPLTAEDIVHKIAARIYEENDRAVFDKIVSKLLNLGLITESQAHTLEDEVAEVLQKLISKEANNYEEDPNKPTSWTENQAGKIPEKVTPMAAIQDGLAKGE
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SCG3
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  Secretogranin 3 Protein (NBP1-89825PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (87%), Rat (88%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Secretogranin 3 Antibody - BSA Free

• SCG3
• Secretogranin III
• secretogranin IIIFLJ90833
• Secretogranin-3
• SGIII

Background

Secretogranin 3 is encoded by this gene is a member of the chromogranin/secretogranin family of neuroendocrine secretory proteins. Granins may serve as precursors for biologically active peptides. Some granins have been shown to function as helper proteins in sorting and proteolytic processing of prohormones; however, the function of this protein is unknown. [provided by RefSeq]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Secretogranin 3 Antibody (NBP1-89825)(2)

Publications using NBP1-89825

• Wang Y, Ji N, Wang J et al. SCG3 Protein Expression in Glioma Associates With less Malignancy and Favorable Clinical Outcomes Pathology and Oncology Research 2021-02-26 [PMID: 34257545]
• Leja J, Essaghir A, Essand M et al. Novel markers for enterochromaffin cells and gastrointestinal neuroendocrine carcinomas. Mod Pathol 2009-02-01 [PMID: 18953328]

Bioinformatics

• Gene Symbol: SCG3