Home » Secretogranin 3 » Secretogranin 3 Antibodies » Secretogranin 3 Antibody

Secretogranin 3 Antibody

 (1 Publication)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Western Blot: Secretogranin 3 Antibody [NBP1-89825] - Analysis in control (vector only transfected HEK293T lysate) and SCG3 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Western Blot: Secretogranin 3 Antibody [NBP1-89825] - Analysis in control (vector only transfected HEK293T lysate) and SCG3 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian ...read more
Orthogonal Strategies: Immunohistochemistry-Paraffin: Secretogranin 3 Antibody [NBP1-89825] - Staining in human cerebral cortex and placenta tissues using anti-SCG3 antibody. Corresponding SCG3 RNA-seq data are ...read more
Western Blot: Secretogranin 3 Antibody [NBP1-89825] - Analysis in human cell line SH-SY5Y.
Immunohistochemistry-Paraffin: Secretogranin 3 Antibody [NBP1-89825] - Staining of human hippocampus shows cytoplasmic positivity in neurons.
Immunohistochemistry-Paraffin: Secretogranin 3 Antibody [NBP1-89825] - Staining of human cerebral cortex shows high expression.
Immunohistochemistry-Paraffin: Secretogranin 3 Antibody [NBP1-89825] - Staining of human placenta shows low expression as expected.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

  

Order Details

100% Guarantee on every product

Secretogranin 3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: LDGTPLTAEDIVHKIAARIYEENDRAVFDKIVSKLLNLGLITESQAHTLEDEVAEVLQKLISKEANNYEEDPNKPTSWTENQAGKIPEKVTPMAAIQDGLAKGE
Specificity
Specificity of human Secretogranin 3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SCG3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Secretogranin 3 Protein (NBP1-89825PEP)
Publications
Read Publication using NBP1-89825.

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (87%), Rat (88%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Secretogranin 3 Antibody

  • SCG3
  • Secretogranin III
  • secretogranin IIIFLJ90833
  • Secretogranin-3
  • SGIII

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Chromogranin C
Antibody
NBP2-15895
Western Blot: Chromogranin C Antibody [NBP2-15895] - A. 50 ug mouse brain lysate/extract 7.5% SDS-PAGE Chromogranin C antibody dilution: 1:500 The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301) was used to detect the primary antibody.
Immunohistochemistry-Paraffin: Chromogranin C Antibody [NBP2-15895] - Paraffin-embedded mouse fore brain. Chromogranin C antibody dilution: 1:500.
Western Blot: Chromogranin C Antibody [NBP2-15895] - Sample (30 ug of whole cell lysate) A: IMR32 B: U87-MG 7. 5% SDS PAGE gel, diluted at 1:1000.
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
POMC Antibody
NB100-1533
Western Blot: POMC Antibody [NB100-1533] - Staining of NIH3T3 cell lysate with antibody at 0.3 ug/mL (A) and Rat Brain cell lysate with antibody at 2 ug/mL (B). 35 ug protein in RIPA buffer. Detected by chemiluminescence.
Immunohistochemistry: POMC Antibody [NB100-1533] - Representative confocal images of POMC in POMC-transfected WT and Sel1L-/- N2a cells. White arrows point to POMC-containing secretory granules, while yellow arrows point to perinuclear POMC. KDEL marks the ER. Representative data from at least 2 independent experiments are shown. Image collected and cropped by CiteAb from the following publication (jci.org/articles/view/96420), licensed under a CC-BY licence.
Flow Cytometry: POMC Antibody [NB100-1533] - Flow cytometric analysis of paraformaldehyde fixed A431 cells (blue line), permeabilized with 0.5% Triton. Primary incubation 1hr (10 ug/mL) followed by Alexa Fluor 488 secondary antibody (1 ug/mL). IgG control: Unimmunized goat IgG (black line) followed by Alexa Fluor 488 secondary antibody.
(10 Publications)
Species: Hu, Mu, Rt, Po, Sh
Applications: WB, Flow, ICC/IF, IHC, IHC-P, PEP-ELISA
Chromogranin A
Antibody
NB120-15160
Immunohistochemistry-Paraffin: Chromogranin A Antibody [NB120-15160] - IHC analysis of a formalin fixed paraffin embedded tissue section of mouse pancreas using Chromogranin A antibody at a dilution of 1:500. The signal was developed using HRP-conjugated anti-rabbit secondary and DAB reagent which followed counterstaining of the section with hematoxylin. The antibody generated a strong staining in Islets of Langerhans. Also, in the periphery of the cells, the pattern of staining was punctate representing the vesicles with Chromogranin A. Cells of lobules and acini showed a weak cytoplasmic and nuclear staining which is potentially the secreted pool of Chromogranin A.
Immunohistochemistry: Chromogranin A Antibody [NB120-15160] - IHC-P analysis fo human pancreas tissue showing specific staining of Chromogranin A in the Islets of Langerhans (dark brown staining).
Immunocytochemistry/Immunofluorescence: Chromogranin A Antibody [NB120-15160] - Neuro2a cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X PBS + 0.05% Triton-X100. The cells were incubated with anti-Chromogranin A Antibody at 2 ug/ml overnight at 4C and detected with an anti-rabbit Dylight 488 (Green) at a 1:500 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
(2 Reviews)
(18 Publications)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Semenogelin II
Antibody
NBP1-92376
Western Blot: Semenogelin II Antibody [NBP1-92376] - Analysis in control (vector only transfected HEK293T lysate) and SEMG2 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: Semenogelin II Antibody [NBP1-92376] - Staining of human kidney.
Immunohistochemistry-Paraffin: Semenogelin II Antibody [NBP1-92376] - Staining of human seminal vesicle shows high expression.
Species: Hu
Applications: WB, IHC, IHC-P
Carboxypeptidase
E/CPE Antibody [Uncon ...
AF3587
A172 human glioblastoma cell line was stained with Goat Anti-Human Carboxypeptidase E/CPE Antigen Affinity‑purified Polyclonal Antibody (Catalog # AF3587, filled histogram) or control antibody (Catalog # AB-108-C, open histogram), followed by Phycoerythrin-conjugated Anti-Goat IgG Secondary Antibody (Catalog # F0107). To facilitate intracellular staining, cells were fixed with paraformaldehyde and permeabilized with methanol and saponin.
Carboxypeptidase E/CPE was detected in immersion fixed HepG2 human hepatocellular carcinoma cell line using Goat Anti-Human Carboxypeptidase E/CPE Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3587) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red, upper panel; Catalog # NL001) and counterstained with DAPI (blue, lower panel). Specific staining was localized to cell surfaces and cytoplasm. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
Carboxypeptidase E/CPE was detected in immersion fixed frozen sections of mouse embryo (9.5 d.p.c.) using Goat Anti-Human Carboxypeptidase E/CPE Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3587) at 10 µg/mL overnight at 4 °C. Tissue was stained using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red; Catalog # NL001) and counterstained with DAPI (blue). Specific staining was localized to the developing liver. View our protocol for Fluorescent IHC Staining of Frozen Tissue Sections.
Species: Hu
Applications: WB, IHC, IP, CyTOF-ready, ICC, ICFlow
Chromogranin B
Antibody
NBP1-80782
Western Blot: Chromogranin B Antibody [NBP1-80782] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Human Adrenal Gland tissue
Immunocytochemistry/Immunofluorescence: Chromogranin B Antibody [NBP1-80782] - Staining of human cell line SH-SY5Y shows localization to vesicles. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Chromogranin B Antibody [NBP1-80782] - Staining of human colon shows strong cytoplasmic positivity in enteroendocrine cells.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Neuropeptide Y
Antibody
NBP1-46535
Immunohistochemistry: Neuropeptide Y Antibody [NBP1-46535] - Low magnification images showing the double staining pattern of NHE1 with neuropeptide NPY. Scale bar: 100um. Insets: High magnification images showing individual cells with double staining. Scale bar: 10um. Asterisks mark Hoechst-stained nuclei. Image collected and cropped by CiteAb from the following publication (nature.com/articles/s41598-019-42872-w), licensed under a CC-BY licence.
(12 Publications)
Species: Hu, Mu, Rt, Rb, Xp, Ze
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-FrFl
CBX4 Antibody
(6C5G3)
NBP2-52432
Western Blot: CBX4 Antibody (6C5G3) [NBP2-52432] - Analysis using CBX4 mAb against human CBX4 (AA: 397-514) recombinant protein. (Expected MW is 43.3 kDa)
Immunohistochemistry-Paraffin: CBX4 Antibody (6C5G3) [NBP2-52432] - Analysis of rectum cancer tissues using CBX4 mouse mAb with DAB staining.
Flow Cytometry: CBX4 Antibody (6C5G3) [NBP2-52432] - Flow cytometric analysis of Hela cells using CBX4 mouse mAb (green) and negative control (red).
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready
Proprotein
Convertase 2/PCSK2 An
AF6018
Western blot shows lysates of MCF‑7 human breast cancer cell line, beta TC‑6 mouse beta cell insulinoma cell line, and HepG2 human hepatocellular carcinoma cell line. PVDF Membrane was probed with 1 µg/mL of Sheep Anti-Human Proprotein Convertase 2/PCSK2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF6018) followed by HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). A specific band was detected for Proprotein Convertase 2/PCSK2 at approximately 70 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Proprotein Convertase 2/PCSK2 was detected in immersion fixed HepG2 human hepatocellular carcinoma cell line using Sheep Anti-Human/Mouse Proprotein Convertase 2/PCSK2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF6018) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Sheep IgG Secondary Antibody (red; Catalog # NL010) and counterstained with DAPI (blue).This application has not been tested in mouse samples. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
(1 Publication)
Species: Hu, Mu
Applications: WB, IP, ICC
Cytokeratin 17
Antibody (E3 (same as ...
NBP2-29421
Western Blot: Cytokeratin 17 Antibody (E3 (same as Ks17.E3)) [NBP2-29421] - Analysis of Cytokeratin 17 in human HeLa lysate using Cytokeratin 17 E3 antibody at 3 ug/ml. goat anti-mouse Ig HRP secondary antibody and PicoTect ECL substrate solution were used for this test.
Immunocytochemistry/Immunofluorescence: Cytokeratin 17 Antibody (E3 (same as Ks17.E3)) [NBP2-29421] - Formalin-paraffin skin stained with CK17 Ab (E3).
Immunohistochemistry-Paraffin: Cytokeratin 17 Antibody (E3 (same as Ks17.E3)) [NBP2-29421] - Formalin-paraffin skin stained with CK17 Ab (E3).
(2 Publications)
Species: Hu, Rt, Po, Bv, Gt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Polycystin 2
Antibody
NBP1-30117
Western Blot: Polycystin 2 Antibody [NBP1-30117] - Whole cell lysate (15 ug) from HeLa and HEK293T cells prepared using NETN lysis buffer. Antibody: Affinity purified rabbit anti-Polycystin-2 antibody used for WB at 0.1 ug/ml. Detection: Chemiluminescence with an exposure time of 3 minutes.
Western Blot: Polycystin 2 Antibody [NBP1-30117] - Whole cell lysate (50 ug) from TCMK-1 and NIH 3T3 cells prepared using NETN lysis buffer. Antibody: Affinity purified rabbit anti-Polycystin-2 antibody used for WB at 0.1 ug/ml. Detection: Chemiluminescence with an exposure time of 75 seconds.
Immunoprecipitation: Polycystin 2 Antibody [NBP1-30117] - Detection of human Polycystin-2 by western blot of immunoprecipitates. Samples: Whole cell lysate (1.0 mg per IP reaction; 20% of IP loaded) from HeLa cells prepared using NETN lysis buffer. Antibodies: Affinity purified rabbit anti-Polycystin-2 antibody NBP1-30117 used for IP at 3 ug per reaction. Polycystin-2 was also immunoprecipitated by another rabbit anti-Polycystin-2 antibody. For blotting immunoprecipitated Polycystin-2, NBP1-30117 was used at 1 ug/ml. Detection: Chemiluminescence with an exposure time of 30 seconds.
Species: Hu, Mu
Applications: WB, IP
Cytokeratin 6b
Antibody
NBP2-14924
Western Blot: Cytokeratin 6b Antibody [NBP2-14924] - Sample (1 ug of whole cell lysate) A: HeLa 7. 5% SDS PAGE; antibody diluted at 1:5000.
Immunocytochemistry/Immunofluorescence: Cytokeratin 6b Antibody [NBP2-14924] - Analysis of methanol-fixed HeLa, using antibody at 1:500 dilution.
Immunohistochemistry-Paraffin: Cytokeratin 6b Antibody [NBP2-14924] - Paraffin-embedded mouse brain, using antibody at 1:500 dilution.
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Thyroglobulin
Antibody (2H11 + 6E1)
NBP2-34294
Immunohistochemistry-Paraffin: Thyroglobulin Antibody (2H11 + 6E1) [NBP2-34294] - Thyroglobulin staining in thyroid tissue of normal C57 mouse (Red). Dilution is 1:100. This image was submitted via customer Review.
Immunohistochemistry-Paraffin: Thyroglobulin Antibody (2H11 + 6E1) [NBP2-34294] - Analysis using Azide/BSA FREE version of NBP2-34294. Human Thyroid stained with Thyroglobulin Ab (2H11 + 6E1).
Immunohistochemistry: Thyroglobulin Antibody (2H11 + 6E1) [NBP2-34294] - Imaging of Mouse stomach tissue. Positive staining can only be observed inside the thyroid cells and the follicle in thyroid tissue. This image was submitted via customer Review.
(2 Reviews)
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P
Kallikrein 3/PSA
[HRP]
DKK300
(1 Review)
(13 Publications)
Species: Hu
PCSK1N Antibody
NBP2-49423
Immunocytochemistry/Immunofluorescence: PCSK1N Antibody [NBP2-49423] - Immunofluorescent staining of human cell line HEK 293 shows localization to vesicles.
Immunohistochemistry-Paraffin: PCSK1N Antibody [NBP2-49423] - Staining of human liver.
Immunohistochemistry-Paraffin: PCSK1N Antibody [NBP2-49423] - Staining of human pancreas shows cytoplasmic positivity in endocrine cells.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Proprotein
Convertase 1/PCSK1 An ...
H00005122-M02
Western Blot: Proprotein Convertase 1/PCSK1 Antibody (3D2) [H00005122-M02] - PCSK1 monoclonal antibody (M02), clone 3D2. Analysis of PCSK1 expression in Raw 264.7.
Immunocytochemistry/Immunofluorescence: Proprotein Convertase 1/PCSK1 Antibody (3D2) [H00005122-M02] - Analysis of monoclonal antibody to PCSK1 on HeLa cell. Antibody concentration 30 ug/ml.
Immunohistochemistry-Paraffin: Proprotein Convertase 1/PCSK1 Antibody (3D2) [H00005122-M02] - Analysis of monoclonal antibody to PCSK1 on formalin-fixed paraffin-embedded human small Intestine. Antibody concentration 3 ug/ml.
(1 Publication)
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
Androgen R/NR3C4
[p Ser213, p Ser210] ...
NB100-56603
Western Blot: Androgen R/NR3C4 [p Ser213, p Ser210] Antibody (156C135.2) [NB100-56603] - Analysis using Azide Free version of NB100-56603. LNCaP cells (passage number 38) were serum-starved for 2 days. After serum starvation, cells were (A) left untreated, (B) treated with 100 ng/ml IGF-1 for 4h, or (C) incubated with 20 um LY294002 for 30 mi
(13 Publications)
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, IHC, IHC-P
FTO Antibody
NB110-60935
Western Blot: FTO Antibody [NB110-60935] - Detection of FTO in human brain lysate using anti-FTO NB110-60935.
(3 Publications)
Species: Hu, Mu, Ch, Pm
Applications: WB, IB, IHC
MTMR9 Antibody
NBP1-31078
Western Blot: MTMR9 Antibody [NBP1-31078] - Sample (30 ug of whole cell lysate) A: Hep G2 7. 5% SDS PAGE MTMR9 antibody, antibody diluted at 1:1000.
Immunocytochemistry/Immunofluorescence: MTMR9 Antibody [NBP1-31078] - Paraformaldehyde-fixed HeLa, using antibody at 1:200 dilution.
Immunohistochemistry-Paraffin: MTMR9 Antibody [NBP1-31078] - Paraffin-embedded mouse lung. MTMR9 antibody [C3], C-term diluted at 1:500.
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Secretogranin 3
Antibody
NBP1-89825
Secretogranin 3 Antibody
Species: Hu
Applications: WB, IHC, IHC-P

Publications for Secretogranin 3 Antibody (NBP1-89825)(1)


Reviews for Secretogranin 3 Antibody (NBP1-89825) (0)

There are no reviews for Secretogranin 3 Antibody (NBP1-89825). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Secretogranin 3 Antibody (NBP1-89825) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Learn about Custom Antibody Labeling

Additional Secretogranin 3 Products

Bioinformatics Tool for Secretogranin 3 Antibody (NBP1-89825)

Discover related pathways, diseases and genes to Secretogranin 3 Antibody (NBP1-89825). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Secretogranin 3 Antibody (NBP1-89825)

Discover more about diseases related to Secretogranin 3 Antibody (NBP1-89825).
 

Pathways for Secretogranin 3 Antibody (NBP1-89825)

View related products by pathway.

PTMs for Secretogranin 3 Antibody (NBP1-89825)

Learn more about PTMs related to Secretogranin 3 Antibody (NBP1-89825).

Blogs on Secretogranin 3

There are no specific blogs for Secretogranin 3, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Secretogranin 3 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol SCG3