Secretogranin 3 Antibody

Images

 
Western Blot: Secretogranin 3 Antibody [NBP1-89825] - Analysis in human cell line SH-SY5Y.
Immunohistochemistry-Paraffin: Secretogranin 3 Antibody [NBP1-89825] - Staining of human hippocampus shows cytoplasmic positivity in neurons.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Secretogranin 3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:LDGTPLTAEDIVHKIAARIYEENDRAVFDKIVSKLLNLGLITESQAHTLEDEVAEVLQKLISKEANNYEEDPNKPTSWTENQAGKIPEKVTPMAAIQDGLAKGE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SCG3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Secretogranin 3 Protein (NBP1-89825PEP)
Publications
Read Publication using NBP1-89825.

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (87%), Rat (88%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Secretogranin 3 Antibody

  • secretogranin IIIFLJ90833
  • secretogranin-3
  • SGIII

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-15895
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NB120-15160
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P
NBP2-50288
Species: Rt
Applications: WB, Flow, ICC/IF, IHC, IP, CyTOF-ready
AF3587
Species: Hu
Applications: WB, IHC, IP, CyTOF-ready, ICC, ICFlow
NBP1-80782
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-46535
Species: Hu, Mu, Rt, Rb, Xp, Ze
Applications: WB, IHC, IHC-Fr, IHC-P
NBP2-52432
Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready, ICC
AF6018
Species: Hu, Mu
Applications: WB, IP, ICC
NBP2-29421
Species: Hu, Rt, Po, Bv, Gt
Applications: WB, ELISA, Flow, ICC/IF, IHC-Fr, IHC-P, IP
NBP1-80944
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-14924
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-34294
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC-P
H00027344-M02
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
H00005122-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC-P
NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P
NB110-60935
Species: Hu, Mu, Pm
Applications: WB
NBP1-31078
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Secretogranin 3 Antibody (NBP1-89825)(1)

Reviews for Secretogranin 3 Antibody (NBP1-89825) (0)

There are no reviews for Secretogranin 3 Antibody (NBP1-89825). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Secretogranin 3 Antibody (NBP1-89825) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Secretogranin 3 Products

Bioinformatics Tool for Secretogranin 3 Antibody (NBP1-89825)

Discover related pathways, diseases and genes to Secretogranin 3 Antibody (NBP1-89825). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Secretogranin 3 Antibody (NBP1-89825)

Discover more about diseases related to Secretogranin 3 Antibody (NBP1-89825).
 

Pathways for Secretogranin 3 Antibody (NBP1-89825)

View related products by pathway.

PTMs for Secretogranin 3 Antibody (NBP1-89825)

Learn more about PTMs related to Secretogranin 3 Antibody (NBP1-89825).

Blogs on Secretogranin 3

There are no specific blogs for Secretogranin 3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Secretogranin 3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SCG3