Semenogelin II Antibody - BSA Free

Images

 
Immunohistochemistry-Paraffin: Semenogelin II Antibody [NBP1-92376] - Staining of human kidney.
Immunohistochemistry-Paraffin: Semenogelin II Antibody [NBP1-92376] - Staining of human seminal vesicle shows high expression.
Immunohistochemistry-Paraffin: Semenogelin II Antibody [NBP1-92376] - Staining of human skeletal muscle shows low expression as expected.
Orthogonal Strategies: Immunohistochemistry-Paraffin: Semenogelin II Antibody [NBP1-92376] - Staining in human seminal vesicle and skeletal muscle tissues using anti-SEMG2 antibody. Corresponding SEMG2 RNA-seq ...read more
Independent Antibodies: Immunohistochemistry-Paraffin: Semenogelin II Antibody [NBP1-92376] - Staining of human colon, kidney, liver and seminal vesicle using Anti-SEMG2 antibody NBP1-92376 (A) shows similar ...read more
Immunohistochemistry-Paraffin: Semenogelin II Antibody [NBP1-92376] - Staining of human colon.
Immunohistochemistry-Paraffin: Semenogelin II Antibody [NBP1-92376] - Staining of human liver.
Analysis in control (vector only transfected HEK293T lysate) and SEMG2 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells).

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Format
BSA Free

Order Details

View Available Formulations
Catalog# & Formulation Size Price

Semenogelin II Antibody - BSA Free Summary

Description
Novus Biologicals Rabbit Semenogelin II Antibody - BSA Free (NBP1-92376) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: EERHLNCGEKGIQKGVSKGSISIQTEEQIHGKSQNQVRIPSQAQEYGHKE
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SEMG2
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Semenogelin II Protein (NBP1-92376PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for Semenogelin II Antibody - BSA Free

  • semenogelin IISGIISemenogelin 2
  • semenogelin-2

Background

Semenogelin I (SgI) and Semenogelin II (SgII) are the major seminal vesicle secreted proteins in human semen (reviewed in Lundwall, 2002 and Bonilha et al, 2006). SgI and SgII, in semen both originate from the glandular epithelium of the seminal vesicles which secrete them at high concentrations. SgII is also secreted by the epididymis at lower concentrations. SgI and SgII interact both non-covalently and covalently by disulphide bridges to instantly form a gel-like coagulum upon ejaculation. Fibronectin is also a key component of the coagulum. The gel structure dissolves spontaneously within minutes after ejaculation as a result of proteolytic degradation of SgI/SgII by prostatic serine protease (PSA) and other proteases which cleave SgI/SgII into fragments. The high concentration of SgI/SgII in human semen led to the concept of SgI/SgII as a potentially useful marker for semen identification (reviewed in Pang and Cheung, 2006). Whereas SgI/SgII were originally identified as the major components present in seminal vesicle secretion, they are now known to be expressed in a number of tissues. The list includes seminal vesicles, epididymis, vas deferens, prostate, skeletal muscle, kidney, colon, trachea, lung, breast and retina as well as in several malignant tissues and cell lines (reviewed in Lundwall, 2002 and Bonilha et al, 2006). The non-genital expression of SgI/SgII suggests that these proteins also have functions that are unrelated to sperm. Human Sg1 is a non-glycosylated protein of 439 amino acids with a molecular weight of ~50 kDa. A few percent of the worlds population also carry an allele that gives rise to a truncated SgI molecule with a molecular mass of 43 kDa. Human SgII is a 559 amino acid protein with a molecular weight of approx. 63 kDa. SgII has a potential site for N-linked glycosylation and approximately half of the molecules in human semen are glycosylated yielding two SgII species with a different of 5 kDa. SgI has a single Cys residue and SgII has two Cys residues, and the molecules can exist as covalent homo- and heteromultimers.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-62693
Species: Hu
Applications: IHC,  IHC-P
NB120-15160
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NB100-56163
Species: Ma, Hu, Mu, Rt
Applications: IHC,  IHC-P, IP, WB
DKK300
Species: Hu
Applications: ELISA
NBP1-80782
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-89825
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-38770
Species: Hu, Mu
Applications:  IHC-P, WB
NBP1-80782
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NB100-1533
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC,  IHC-P, PEP-ELISA, WB
AF1445
Species: Mu, Rt
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, Neut, Simple Western, WB
NB600-534
Species: Hu, Mu, Po, V-Vi
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, In vitro, In vivo, RIA, WB
NBP1-30475
Species: Hu, Mu
Applications: IHC,  IHC-P, IP, WB
AF6018
Species: Hu, Mu
Applications: ICC, IP, WB
NBP2-52432
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, IHC,  IHC-P, WB
NBP2-29421
Species: Bv, Gt, Hu, Po, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NBP1-80944
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP2-14924
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
AF1067
Species: Hu, Mu, Rt
Applications: ELISA, IHC, Neut, WB
MAB1417
Species: Bv, Hu, Mu
Applications: ICC, IHC
NBP1-90927
Species: Hu
Applications: IHC,  IHC-P, WB

Publications for Semenogelin II Antibody (NBP1-92376) (0)

There are no publications for Semenogelin II Antibody (NBP1-92376).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Semenogelin II Antibody (NBP1-92376) (0)

There are no reviews for Semenogelin II Antibody (NBP1-92376). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Semenogelin II Antibody (NBP1-92376) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Semenogelin II Products

Research Areas for Semenogelin II Antibody (NBP1-92376)

Find related products by research area.

Blogs on Semenogelin II

There are no specific blogs for Semenogelin II, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Semenogelin II Antibody - BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol SEMG2