Semaphorin 4G Antibody - BSA Free

Immunohistochemistry-Paraffin: Semaphorin 4G Antibody [NBP1-82171] - Staining of human rectum shows strong membranous /cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: Semaphorin 4G Antibody [NBP1-82171] - Staining of human cerebellum shows moderate to strong membranous /cytoplasmic positivity in all layers.

Immunohistochemistry-Paraffin: Semaphorin 4G Antibody [NBP1-82171] - Staining of human lymph node shows low positivity in germinal center cells as expected.

Immunohistochemistry-Paraffin: Semaphorin 4G Antibody [NBP1-82171] - Staining of human prostate shows weak membranous positivity in glandular cells.

• Reactivity: Hu, Rt
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Semaphorin 4G Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Semaphorin 4G Antibody - BSA Free (NBP1-82171) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: ATPRMTIPYEELSGTRHFKGQAQNYSTLLLEEASARLLVGARGALFSLSANDIGDGAHKEIHWEASPEMQSKCH
• Predicted Species: Rat (92%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SEMA4G
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  Semaphorin 4G Protein (NBP1-82171PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (86%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Semaphorin 4G Antibody - BSA Free

• KIAA1619FLJ20590
• MGC102867
• sema domain, immunoglobulin domain (Ig), transmembrane domain (TM) and shortcytoplasmic domain, (semaphorin) 4G
• SEMA4G
• Semaphorin 4G
• semaphorin-4G

Background

Semaphorins are a large family of conserved secreted and membrane associated proteins which possess a semaphorin (Sema) domain and a PSI domain (found in plexins, semaphorins and integrins) in the N-terminal extracellular portion. Based on sequence and structural similarities, semaphorins are put into eight classes: invertebrates contain classes 1 and 2, viruses have class V, and vertebrates contain classes 3-7. Semaphorins serve as axon guidance ligands via multimeric receptor complexes, some (if not all) containing plexin proteins. This gene encodes a class 4 semaphorin. This gene and the gene for mitochondrial ribosomal protein L43 overlap at map location 10q24.31 and are transcribed in opposite directions.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SEMA4G
• Entrez:
  • 57715(Human)
• Uniprot:
  • Q9NTN9()