NKX2.3 Antibody

Images

 
Immunohistochemistry-Paraffin: NKX2.3 Antibody [NBP2-13659] - Staining of human skeletal muscle shows strong cytoplasmic positivity in myocytes.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

NKX2.3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: DEEDEGEKLSYLNSLAAADGHGDSGLCPQGYVHTVLRDSCSEPKEHEEEP EVVRDRSQKSCQLKKSLETAGDCKAAEESERPKPR
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NKX2-3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
NKX2.3 Protein (NBP2-13659PEP)

Reactivity Notes

Mouse (82%), Rat (84%).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for NKX2.3 Antibody

  • CSX3NK2.3
  • Homeobox protein NK-2 homolog C
  • homeobox protein Nkx-2.3
  • NK2 transcription factor related, locus 3 (Drosophila)
  • NKX2.3
  • NKX23
  • NKX2CNK-2 (Drosophila) homolog C
  • NKX4-3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NBP1-76377
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-31558
Species: Hu, Mu
Applications: WB, Flow, ICC/IF
MAB1930
Species: Hu, Mu, Rt
Applications: WB
NBP2-47559
Species: Hu
Applications: WB, IHC, IHC-P
AF993
Species: Mu
Applications: WB, IHC
NB110-60928
Species: Hu, Mu, Rt, Bv, Ca, Pm
Applications: WB, EM, IHC, IHC-P
NB600-1147
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, IHC-P, Flow-CS
MAB7442
Species: Hu
Applications: WB, B/N
NBP2-22471
Species: Hu, Mu, Rt, Mk, Pm
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
NBP1-88542
Species: Hu
Applications: IHC, IHC-P
NBP2-41161
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC
NBP2-44501
Species: Hu, Mu, Rt
Applications: Flow, IHC-P, IF
NBP2-03868
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-13659
Species: Hu
Applications: IHC, IHC-P

Publications for NKX2.3 Antibody (NBP2-13659) (0)

There are no publications for NKX2.3 Antibody (NBP2-13659).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NKX2.3 Antibody (NBP2-13659) (0)

There are no reviews for NKX2.3 Antibody (NBP2-13659). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for NKX2.3 Antibody (NBP2-13659) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NKX2.3 Products

Bioinformatics Tool for NKX2.3 Antibody (NBP2-13659)

Discover related pathways, diseases and genes to NKX2.3 Antibody (NBP2-13659). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NKX2.3 Antibody (NBP2-13659)

Discover more about diseases related to NKX2.3 Antibody (NBP2-13659).
 

Pathways for NKX2.3 Antibody (NBP2-13659)

View related products by pathway.

PTMs for NKX2.3 Antibody (NBP2-13659)

Learn more about PTMs related to NKX2.3 Antibody (NBP2-13659).

Blogs on NKX2.3

There are no specific blogs for NKX2.3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NKX2.3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NKX2-3