NKX2.3 Antibody - BSA Free

Immunohistochemistry-Paraffin: NKX2.3 Antibody [NBP2-13659] - Staining of human skeletal muscle shows moderate cytoplasmic positivity in myocytes.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

NKX2.3 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit NKX2.3 Antibody - BSA Free (NBP2-13659) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: DEEDEGEKLSYLNSLAAADGHGDSGLCPQGYVHTVLRDSCSEPKEHEEEPEVVRDRSQKSCQLKKSLETAGDCKAAEESERPKPR
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NKX2-3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  NKX2.3 Protein (NBP2-13659PEP)

Reactivity Notes

Mouse (82%), Rat (84%).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for NKX2.3 Antibody - BSA Free

• CSX3NK2.3
• Homeobox protein NK-2 homolog C
• homeobox protein Nkx-2.3
• NK2 transcription factor related, locus 3 (Drosophila)
• NKX2.3
• NKX23
• NKX2CNK-2 (Drosophila) homolog C
• NKX4-3

Background

NKX2C is a member of the NKX family of homeodomain-containing transcription factors, which are implicated in many aspects of cell type specification and maintenance of differentiated tissue functions. See Harvey (1996) [PubMed 8812123] for a review of the structure, regulation, function, and evolution of NK2 homeobox genes with an emphasis on their roles in heart development.[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: NKX2-3