Semaphorin 4A Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: Semaphorin 4A Antibody [NBP2-56706] - Staining of human cell line RT4 shows localization to nucleoplasm & cell junctions.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Semaphorin 4A Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: PNLNSWKQDMERGNPEWACASGPMSRSLRPQSRPQIIKEVLAVPNSILELPCPHLSALASYYWSHGPAAVPEASSTVYNGSLLLIVQDGVGGLYQCWATENGFSYPVISYWVDSQDQTLALDPELAGIPREHVKVPLTRVSGGA
Specificity
Specificity of human Semaphorin 4A antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SEMA4A
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Semaphorin 4A Recombinant Protein Antigen (NBP2-56706PEP)

Reactivity Notes

Rat 81%

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, pH 7.2, containing 40% glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for Semaphorin 4A Antibody

  • CORD10
  • RP35
  • Sema B
  • sema domain, immunoglobulin domain (Ig), transmembrane domain (TM) and shortcytoplasmic domain, (semaphorin) 4A
  • SEMA4A
  • SEMAB
  • Semaphorin 4A
  • semaphorin-4A
  • semaphorin-B
  • SEMB
  • SEMBFLJ12287

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-25198
Species: Hu
Applications: Flow, IP, Flow-CS
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NB100-64350
Species: Hu
Applications: WB, Flow, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready
NBP1-84550
Species: Hu
Applications: WB, IHC, IHC-P
MAB46941
Species: Hu
Applications: WB, IHC
AF4160
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, Neut
AF3749
Species: Hu
Applications: WB, IHC
AF1885
Species: Mu
Applications: WB, IHC
AF1885
Species: Mu
Applications: WB, IHC
NBP1-06274
Species: Hu, Mu, Rt, Ch, Dr, Sh
Applications: WB, Simple Western, Flow, ICC/IF
NBP1-83219
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-92684
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF, IHC
NB600-1335
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, GS, ICC/IF, IHC, IHC-P, IP
AF5329
Species: Hu
Applications: WB, IHC
NBP1-83363
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Semaphorin 4A Antibody (NBP2-56706) (0)

There are no publications for Semaphorin 4A Antibody (NBP2-56706).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Semaphorin 4A Antibody (NBP2-56706) (0)

There are no reviews for Semaphorin 4A Antibody (NBP2-56706). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Semaphorin 4A Antibody (NBP2-56706) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for Semaphorin 4A Antibody (NBP2-56706)

Discover related pathways, diseases and genes to Semaphorin 4A Antibody (NBP2-56706). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Semaphorin 4A Antibody (NBP2-56706)

Discover more about diseases related to Semaphorin 4A Antibody (NBP2-56706).
 

Pathways for Semaphorin 4A Antibody (NBP2-56706)

View related products by pathway.

Research Areas for Semaphorin 4A Antibody (NBP2-56706)

Find related products by research area.

Blogs on Semaphorin 4A

There are no specific blogs for Semaphorin 4A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Semaphorin 4A Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SEMA4A
Entrez