Semaphorin 3E Antibody


Immunocytochemistry/ Immunofluorescence: Semaphorin 3E Antibody [NBP2-55853] - Staining of human cell line MCF7 shows localization to nucleoplasm & vesicles.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF

Order Details

Semaphorin 3E Antibody Summary

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: RHGNAAQQCFGQQFVGDALDKTEEHLAYGIENNSTLLECTPRSLQAKVIWFVQKGRETRKEEVKTDDRVVK
Specificity of human Semaphorin 3E antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (93%), Rat (92%). Backed by our 100% Guarantee.
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Semaphorin 3E Recombinant Protein Antigen (NBP2-55853PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Affinity purified

Alternate Names for Semaphorin 3E Antibody

  • (semaphorin) 3E
  • coll-5
  • sema domain, immunoglobulin domain (Ig), short basic domain, secreted
  • Sema3E
  • SEMAHM-SemaK
  • Semaphorin 3E
  • semaphorin-3E


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, Neut
Species: Mu, Rt
Applications: WB, Flow, IHC, Block, CyTOF-ready
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, IHC, Block, CyTOF-ready
Species: Hu, Mu, Rt, Bv, Ca, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready
Species: Hu, Mu
Applications: WB, IHC, ICC
Species: Mu
Applications: WB, Flow, IHC, CyTOF-ready, Neut
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC, KO
Species: Mu, Rt
Applications: WB, IHC
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Po, Ca, Ha, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, B/N
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
Species: Hu, Mu, Rt
Applications: ICC/IF

Publications for Semaphorin 3E Antibody (NBP2-55853) (0)

There are no publications for Semaphorin 3E Antibody (NBP2-55853).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Semaphorin 3E Antibody (NBP2-55853) (0)

There are no reviews for Semaphorin 3E Antibody (NBP2-55853). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Semaphorin 3E Antibody (NBP2-55853) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional Semaphorin 3E Products

Bioinformatics Tool for Semaphorin 3E Antibody (NBP2-55853)

Discover related pathways, diseases and genes to Semaphorin 3E Antibody (NBP2-55853). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Semaphorin 3E Antibody (NBP2-55853)

Discover more about diseases related to Semaphorin 3E Antibody (NBP2-55853).

Pathways for Semaphorin 3E Antibody (NBP2-55853)

View related products by pathway.

PTMs for Semaphorin 3E Antibody (NBP2-55853)

Learn more about PTMs related to Semaphorin 3E Antibody (NBP2-55853).

Research Areas for Semaphorin 3E Antibody (NBP2-55853)

Find related products by research area.

Blogs on Semaphorin 3E

There are no specific blogs for Semaphorin 3E, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Semaphorin 3E Antibody and receive a gift card or discount.


Gene Symbol SEMA3E