SEC62 Antibody

Images

 
Western Blot: SEC62 Antibody [NBP1-84045] - Analysis in human cell line A-431.
Immunocytochemistry/ Immunofluorescence: SEC62 Antibody [NBP1-84045] - Staining of human cell line A-431 shows positivity in endoplasmic reticulum.
Immunohistochemistry-Paraffin: SEC62 Antibody [NBP1-84045] - Staining of human prostate shows moderate cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SEC62 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:GGRHHFWFLPNLTADVGFIDSFRPLYTHEYKGPKADLKKDEKSETKKQQKSDSEEKSDSEKKEDEEGKVGPGNHGTEGSGGERHSDTDSDRREDDRSQHSSGNGNDFEMITKEELEQQTDGDCEEDEEEENDGETPKSS
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (91%), Rat (90%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SEC62
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
SEC62 Protein (NBP1-84045PEP)
Publications
Read Publications using
NBP1-84045 in the following applications:

  • WB
    2 publications

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23764425)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SEC62 Antibody

  • Dtrp1
  • hTP-1
  • S.cerevisiae, homolog of
  • SEC62 homolog (S. cerevisiae)
  • TLOC1
  • TP-1
  • translocation protein 1
  • translocation protein SEC62

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-31267
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-30405
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-06274
Species: Hu, Mu, Rt, Ch, Dr, Sh
Applications: WB, Simple Western, Flow, ICC/IF
AF1543
Species: Hu
Applications: WB, IHC
NBP1-87822
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-07755
Species: Hu
NB100-74480
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-317
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
AF3848
Species: Hu
Applications: WB, IHC, IP
NBP1-88370
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-98844
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
NBP2-45897
Species: Hu
Applications: WB, IHC
NBP1-77285
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IF
NBP1-32108
Species: Hu, Rt
Applications: WB, ICC/IF
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P

Publications for SEC62 Antibody (NBP1-84045)(2)

We have publications tested in 1 confirmed species: Canine.

We have publications tested in 1 application: WB.


Filter By Application
WB
(2)
All Applications
Filter By Species
Canine
(1)
All Species

Reviews for SEC62 Antibody (NBP1-84045) (0)

There are no reviews for SEC62 Antibody (NBP1-84045). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for SEC62 Antibody (NBP1-84045) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SEC62 Products

Bioinformatics Tool for SEC62 Antibody (NBP1-84045)

Discover related pathways, diseases and genes to SEC62 Antibody (NBP1-84045). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SEC62 Antibody (NBP1-84045)

Discover more about diseases related to SEC62 Antibody (NBP1-84045).
 

Pathways for SEC62 Antibody (NBP1-84045)

View related products by pathway.

PTMs for SEC62 Antibody (NBP1-84045)

Learn more about PTMs related to SEC62 Antibody (NBP1-84045).

Blogs on SEC62

There are no specific blogs for SEC62, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SEC62 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SEC62