SEC62 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: SEC62 Antibody [NBP1-84045] - Staining of human cell line A-431 shows positivity in endoplasmic reticulum. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: SEC62 Antibody [NBP1-84045] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neurons.

Immunohistochemistry-Paraffin: SEC62 Antibody [NBP1-84045] - Staining of human skeletal muscle shows weak cytoplasmic positivity in myocytes.

Immunohistochemistry-Paraffin: SEC62 Antibody [NBP1-84045] - Staining of human endometrium shows moderate cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: SEC62 Antibody [NBP1-84045] - Staining of human prostate shows moderate cytoplasmic positivity in glandular cells.

Analysis in human cell line A-431.

• Reactivity: Hu, Ca, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

SEC62 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit SEC62 Antibody - BSA Free (NBP1-84045) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-SEC62 Antibody: Cited in 6 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: GGRHHFWFLPNLTADVGFIDSFRPLYTHEYKGPKADLKKDEKSETKKQQKSDSEEKSDSEKKEDEEGKVGPGNHGTEGSGGERHSDTDSDRREDDRSQHSSGNGNDFEMITKEELEQQTDGDCEEDEEEENDGETPKSS
• Predicted Species: Mouse (91%), Rat (90%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SEC62
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  SEC62 Protein (NBP1-84045PEP)

Reactivity Notes

Canine reactivity reported in scientific literature (PMID: 26634806).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for SEC62 Antibody - BSA Free

• Dtrp1
• hTP-1
• S.cerevisiae, homolog of
• SEC62 homolog (S. cerevisiae)
• TLOC1
• TP-1
• translocation protein 1
• translocation protein SEC62

Background

The Sec61 complex is the central component of the protein translocation apparatus of the endoplasmic reticulum (ER) membrane. The protein encoded by this gene and SEC63 protein are found to be associated with ribosome-free SEC61 complex. It is speculated that Sec61-Sec62-Sec63 may perform post-translational protein translocation into the ER. The Sec61-Sec62-Sec63 complex might also perform the backward transport of ER proteins that are subject to the ubiquitin-proteasome-dependent degradation pathway. The encoded protein is an integral membrane protein located in the rough ER. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for SEC62 Antibody (NBP1-84045)(6)

Publications using NBP1-84045

• Ishii S, Chino H, Ode KL et al. CCPG1 recognizes ER luminal proteins for selective ER-phagy Molecular biology of the cell 2023-02-03 [PMID: 36735498] (WB, Human)
• Kennedy A, Ren HY, Madden VJ, Cyr DM. Lysosome docking to WIPI1 rings and ER-connected phagophores occurs during DNAJB12- and GABARAP-dependent selective autophagy of misfolded P23H-rhodopsin Molecular Biology of the Cell 2022-08-01 [PMID: 35704470] (Western Blot)
• Lihua H, Andrew K, Scott H et al. DNAJB12 and Hsp70 Triage Arrested Intermediates of N1303K-CFTR for ER Associated-Autophagy. Mol Biol Cell. 2021-02-03 [PMID: 33534640] (Western Blot)
• Chino, H;Hatta, T;Natsume, T;Mizushima, N; Intrinsically Disordered Protein TEX264 Mediates ER-phagy Mol. Cell 2019-04-11 [PMID: 31006538] (WB, Human)
• Bhalchandra Jadhav, Michael McKenna, Nicholas Johnson et al. Mammalian SRP receptor switches the Sec61 translocase from Sec62 to SRP-dependent translocation. Nature Communications 2015-01-01 [PMID: 26634806] (WB, Canine)
• Hagerstrand D, Tong A, Schumacher SE et al. Systematic interrogation of 3q26 identifies TLOC1 and SKIL as cancer drivers. Cancer Discov 2013-09-01 [PMID: 23764425] (WB)

Bioinformatics

• Gene Symbol: SEC62