SEC63 Antibody


Western Blot: SEC63 Antibody [NBP2-30405] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10. Lane 2: SK-MEL-30
Immunocytochemistry/ Immunofluorescence: SEC63 Antibody [NBP2-30405] - Staining of human cell line Hep G2 shows localization to endoplasmic reticulum.
Immunohistochemistry-Paraffin: SEC63 Antibody [NBP2-30405] - Staining of human pancreas shows moderate cytoplasmic positivity in exocrine glandular cells.
Immunohistochemistry-Paraffin: SEC63 Antibody [NBP2-30405] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.
Immunohistochemistry-Paraffin: SEC63 Antibody [NBP2-30405] - Staining of human skeletal muscle shows low expression as expected.
Immunohistochemistry-Paraffin: SEC63 Antibody [NBP2-30405] - Staining of human testis shows high expression.
Orthogonal Strategies: Immunohistochemistry-Paraffin: SEC63 Antibody [NBP2-30405] - Analysis in human testis and skeletal muscle tissues using NBP2-30405 antibody. Corresponding SEC63 RNA-seq data are presented more
Immunohistochemistry-Paraffin: SEC63 Antibody [NBP2-30405] - Staining of human testis shows strong granular cytoplasmic positivity in cells in seminiferous ducts.
Immunohistochemistry-Paraffin: SEC63 Antibody [NBP2-30405] - Staining of human salivary gland shows strong granular cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: SEC63 Antibody [NBP2-30405] - Staining of human skeletal muscle shows no positivity in myocytes as expected.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Validated by:

Orthogonal Strategies


Order Details

SEC63 Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: REYQEYNPYEVLNLDPGATVAEIKKQYRLLSLKYHPDKGGDEVMFMRIAKAYAALTDEESRKNWEEFGNPDGPQATSFGIALPA
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
SEC63 Protein (NBP2-30405PEP)
Read Publication using NBP2-30405.

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for SEC63 Antibody

  • PRO2507
  • SEC63 homolog (S. cerevisiae)
  • SEC63LERdj2
  • SEC63-like (S. cerevisiae)
  • translocation protein SEC63 homolog


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Ce, Ch, Dr, Hu, Mu, Rt, Sh, Ze
Applications: Flow, ICC/IF, IHC-FrFl, IHC, IHC-P, Simple Western, WB
Species: Hu
Applications: IHC, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Ca, Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, ICC/IF (-), IHC, WB
Species: Ca, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, ICC/IF, PLA, S-ELISA, WB
Species: Hu
Applications: ICC/IF, WB
Species: Bv, Ha, Hu, Pm, Mu, Po, Pm, Rb, Rt
Applications: B/N, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IM, IP, KD, WB
Species: Av, Bv, Ch, Dr, Gp, Hu, Mu, Po, Rb, Rt, Sh, Xp, Ze
Applications: ICC/IF, IHC, IHC-P, IP, Simple Western, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, WB
Species: Ca, Hu, Pm, Mu, Rt
Applications: CyTOF-ready, Flow, IHC, WB
Species: Hu
Applications: IHC, WB

Publications for SEC63 Antibody (NBP2-30405)(1)

Reviews for SEC63 Antibody (NBP2-30405) (0)

There are no reviews for SEC63 Antibody (NBP2-30405). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for SEC63 Antibody (NBP2-30405) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional SEC63 Products

Bioinformatics Tool for SEC63 Antibody (NBP2-30405)

Discover related pathways, diseases and genes to SEC63 Antibody (NBP2-30405). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SEC63 Antibody (NBP2-30405)

Discover more about diseases related to SEC63 Antibody (NBP2-30405).

Pathways for SEC63 Antibody (NBP2-30405)

View related products by pathway.

PTMs for SEC63 Antibody (NBP2-30405)

Learn more about PTMs related to SEC63 Antibody (NBP2-30405).

Blogs on SEC63

There are no specific blogs for SEC63, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our SEC63 Antibody and receive a gift card or discount.


Gene Symbol SEC63