SDSL Antibody


Western Blot: SDSL Antibody [NBP1-53180] - NCI-H226 cell lysate, concentration 0.2-1 ug/ml.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

SDSL Antibody Summary

Synthetic peptides corresponding to SDSL(serine dehydratase-like) The peptide sequence was selected from the middle region of SDSL. Peptide sequence ALAAIYSGLLRRLQAEGCLPPSLTSVVVIVCGGNNINSRELQALKTHLGQ.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against SDSL and was validated on Western blot.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for SDSL Antibody

  • EC
  • EC
  • L-serine deaminase
  • L-serine dehydratase/L-threonine deaminase
  • L-threonine dehydratase
  • SDH 2
  • SDH
  • SDS-RS1
  • Serine dehydratase 2
  • serine dehydratase related sequence 1
  • serine dehydratase-like
  • TDH


SDSL has low serine dehydratase and threonine dehydratase activity.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, KD
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, IHC-P
Species: Hu, Mk, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Ze
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Po
Applications: WB, Simple Western, ICC/IF
Species: Hu, Mu
Applications: WB, IB, IHC-Fr, IP
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Mu
Applications: WB

Publications for SDSL Antibody (NBP1-53180) (0)

There are no publications for SDSL Antibody (NBP1-53180).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SDSL Antibody (NBP1-53180) (0)

There are no reviews for SDSL Antibody (NBP1-53180). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SDSL Antibody (NBP1-53180) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional SDSL Products

Bioinformatics Tool for SDSL Antibody (NBP1-53180)

Discover related pathways, diseases and genes to SDSL Antibody (NBP1-53180). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SDSL Antibody (NBP1-53180)

Discover more about diseases related to SDSL Antibody (NBP1-53180).

Pathways for SDSL Antibody (NBP1-53180)

View related products by pathway.

PTMs for SDSL Antibody (NBP1-53180)

Learn more about PTMs related to SDSL Antibody (NBP1-53180).

Blogs on SDSL

There are no specific blogs for SDSL, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our SDSL Antibody and receive a gift card or discount.


Gene Symbol SDSL