SDSL Antibody

Images

 
Western Blot: SDSL Antibody [NBP1-53180] - NCI-H226 cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SDSL Antibody Summary

Immunogen
Synthetic peptides corresponding to SDSL(serine dehydratase-like) The peptide sequence was selected from the middle region of SDSL. Peptide sequence ALAAIYSGLLRRLQAEGCLPPSLTSVVVIVCGGNNINSRELQALKTHLGQ.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SDSL
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against SDSL and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for SDSL Antibody

  • EC 4.3.1.17
  • EC 4.3.1.19
  • L-serine deaminase
  • L-serine dehydratase/L-threonine deaminase
  • L-threonine dehydratase
  • SDH 2
  • SDH
  • SDS-RS1
  • Serine dehydratase 2
  • serine dehydratase related sequence 1
  • serine dehydratase-like
  • TDH

Background

SDSL has low serine dehydratase and threonine dehydratase activity.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-02126
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-87069
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-34014
Species: Hu
Applications: IHC, IHC-P
NBP1-92372
Species: Hu
Applications: IHC, IHC-P
NBP1-32259
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00006391-M01
Species: Hu
Applications: WB, ELISA, IHC-P
NBP2-02615
Species: Hu, Mk, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-01506
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP1-32398
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-34980
Species: Hu
NBP1-54755
Species: Hu
Applications: WB
NBP2-22449
Species: Hu, Mu, Rt, Fe, GP, Rb
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, GS
NBP1-89146
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-43648
Species: Hu, Mu, Rt, Ze
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-20383
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-71688
Species: Hu, Mu, Po
Applications: WB, Simple Western, ICC/IF
NB100-236
Species: Hu, Mu
Applications: WB, IB, IHC, IHC-Fr, IHC-P, IP
NBP2-02332
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-80533
Species: Mu
Applications: WB

Publications for SDSL Antibody (NBP1-53180) (0)

There are no publications for SDSL Antibody (NBP1-53180).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SDSL Antibody (NBP1-53180) (0)

There are no reviews for SDSL Antibody (NBP1-53180). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SDSL Antibody (NBP1-53180) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SDSL Products

Bioinformatics Tool for SDSL Antibody (NBP1-53180)

Discover related pathways, diseases and genes to SDSL Antibody (NBP1-53180). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SDSL Antibody (NBP1-53180)

Discover more about diseases related to SDSL Antibody (NBP1-53180).
 

Pathways for SDSL Antibody (NBP1-53180)

View related products by pathway.

PTMs for SDSL Antibody (NBP1-53180)

Learn more about PTMs related to SDSL Antibody (NBP1-53180).

Blogs on SDSL

There are no specific blogs for SDSL, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SDSL Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SDSL
Uniprot