SCYL1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: SCYL1 Antibody [NBP1-83365] - Immunofluorescent staining of human cell line A-431 shows localization to cytosol.
Immunohistochemistry-Paraffin: SCYL1 Antibody [NBP1-83365] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells and endothelial cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SCYL1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:AFPEDFCRHKVLPQLLTAFEFGNAGAVVLTPLFKVGKFLSAEEYQQKIIPVVVKMFSSTDRAMRIRLLQQMEQFIQYLDEPTVNTQIFPHVVHGFLDTNPAIREQTVKSMLLLAPKLNEANLNVELMK
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (96%), Rat (95%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SCYL1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
SCYL1 Protein (NBP1-83365PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SCYL1 Antibody

  • Coated vesicle-associated kinase of 90 kDa
  • CVAK90
  • GKLPTelomerase transcriptional element-interacting factor
  • likely ortholog of mouse N-terminal kinase-like protein
  • MGC78454
  • NKTL
  • N-terminal kinase-like protein
  • NTKLN-terminal kinase-like
  • P105
  • SCY1-like 1 (S. cerevisiae)
  • TAPKTeratoma-associated tyrosine kinase
  • TEIFSCY1-like protein 1
  • Telomerase regulation-associated protein
  • telomerase transcriptional elements-interacting factor
  • TRAPHT019

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
NB100-56505
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready
NB100-56508
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P, CyTOF-ready, Flow-CS
MAB1419
Species: Hu, Rt
Applications: IHC, CyTOF-ready, ICC, ICFlow
H00001513-M01
Species: Hu
Applications: WB, ELISA, IHC-P
NB100-317
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
DDX0131P-100
Species: Hu
Applications: Flow, Func, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-88650
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-01345
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-35213
Species: Hu
AF2699
Species: Hu, Mu
Applications: WB, Simple Western, ChIP, ICC
NB600-225
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP2-02665
Species: Hu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P

Publications for SCYL1 Antibody (NBP1-83365) (0)

There are no publications for SCYL1 Antibody (NBP1-83365).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SCYL1 Antibody (NBP1-83365) (0)

There are no reviews for SCYL1 Antibody (NBP1-83365). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for SCYL1 Antibody (NBP1-83365) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SCYL1 Products

Bioinformatics Tool for SCYL1 Antibody (NBP1-83365)

Discover related pathways, diseases and genes to SCYL1 Antibody (NBP1-83365). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SCYL1 Antibody (NBP1-83365)

Discover more about diseases related to SCYL1 Antibody (NBP1-83365).
 

Pathways for SCYL1 Antibody (NBP1-83365)

View related products by pathway.

Research Areas for SCYL1 Antibody (NBP1-83365)

Find related products by research area.

Blogs on SCYL1.

The diverse functions of RANKL/TRANCE/TNFSF11
RANKL (also known as TNF-related activation-induced cytokine), or receptor activator of nuclear factor-?B ligand, was first discovered as a key player in the RANKL/RANK/OPG osteoclast formation pathway. Osteoclasts are large multinucleate cells t...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SCYL1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SCYL1