![Western Blot: SCRT1 Antibody [NBP2-83500] - Host: Rabbit. Target Name: Scrt1. Sample Type: Rat Stomach lysates. Antibody Dilution: 1.0ug/ml](http://images.novusbio.com/fullsize/SCRT1-Antibody-Western-Blot-NBP2-83500-img0001.jpg "Western Blot: SCRT1 Antibody [NBP2-83500] - Host: Rabbit. Target Name: Scrt1. Sample Type: Rat Stomach lysates. Antibody Dilution: 1.0ug/ml")
| Reactivity | RtSpecies Glossary |
| Applications | WB |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Concentration | 0.5 mg/ml |
| Description | Novus Biologicals Rabbit SCRT1 Antibody - BSA Free (NBP2-83500) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of Rat SCRT1. Peptide sequence: MPRSFLVKKVKLDTFSSADLDSSYGRARSDLGVRLQDKGYLSDYVGPASV The peptide sequence for this immunogen was taken from within the described region. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | SCRT1 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS, 2% Sucrose |
| Preservative | 0.09% Sodium Azide |
| Concentration | 0.5 mg/ml |
| Purity | Affinity purified |
![Immunocytochemistry E-Cadherin Antibody [Unconjugated]](https://images.novusbio.com/images2/ECadherin_AF748_Immunocytochemistry_15885.jpg)
![Immunohistochemistry E-Cadherin Antibody [Unconjugated]](https://images.novusbio.com/images2/ECadherin_AF748_Immunohistochemistry_15886.jpg)
![Immunocytochemistry E-Cadherin Antibody [Unconjugated]](https://images.novusbio.com/images2/ECadherin_AF748_Immunocytochemistry_16572.jpg)
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | SCRT1 |
![Western Blot Snail Antibody [Unconjugated]](https://images.novusbio.com/images2/Snail_AF3639_Western_Blot_5320.jpg)
![Intracellular Staining by Flow Cytometry Snail Antibody [Unconjugated]](https://images.novusbio.com/images2/Snail_AF3639_Flow_Cytometry_20834.jpg)
![Chromatin Immunoprecipitation (ChIP) Snail Antibody [Unconjugated]](https://images.novusbio.com/images2/Snail_AF3639_Chromatin_Immunoprecipitation_11236.jpg)
![Knockout Validated Calcitonin R Antibody (462802) [Unconjugated]](https://images.novusbio.com/images2/Calcitonin_R_MAB4614_Knockout_Validated_23018.jpg)
![Flow Cytometry Calcitonin R Antibody (462802) [Unconjugated]](https://images.novusbio.com/images2/Calcitonin_R_MAB4614_Flow_Cytometry_8474.jpg)
![Immunocytochemistry/ Immunofluorescence Calcitonin R Antibody (462802) [Unconjugated]](https://images.novusbio.com/images/mab4614_human-calcitonin-r-mab-clone-462802-41202410484315.jpg)
![Bioactivity IL-4 [Unconjugated]](https://images.novusbio.com/images/protein/6507-ilcf_recombinant-human-il-4-cho-expressed-protein-cf-bioactivity-272020133214.jpg)
![Immunohistochemistry ASCL1/Mash1 Antibody [Unconjugated]](https://images.novusbio.com/images/antibody/af2567_mouse-ascl1-mash1-affinity-purified-polyclonal-ab-immunohistochemistry-1732021122114.jpg)
![Intracellular Staining by Flow Cytometry Reg1A Antibody (431202) [Unconjugated]](https://images.novusbio.com/images2/Reg1A_MAB4937_Flow_Cytometry_8512.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")