SATB2 Antibody - BSA Free

Immunohistochemistry-Paraffin: SATB2 Antibody [NBP1-92365] - Analysis in human colon and liver tissues. Corresponding SATB2 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: SATB2 Antibody [NBP1-92365] - Staining of human cerebral cortex, colon, liver and rectum using Anti-SATB2 antibody NBP1-92365 (A) shows similar protein distribution across tissues to independent antibody NBP1-83619 (B).

Western Blot: SATB2 Antibody [NBP1-92365] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10. Lane 2: HELA

Immunocytochemistry/Immunofluorescence: SATB2 Antibody [NBP1-92365] - Staining of human cell line U-2 OS shows localization to nucleoplasm. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: SATB2 Antibody [NBP1-92365] - Staining of human liver shows no positivity in hepatocytes as expected.

Immunohistochemistry-Paraffin: SATB2 Antibody [NBP1-92365] - Staining of human cerebral cortex shows moderate nuclear positivity in neurons.

Staining of human liver shows no positivity in hepatocytes as expected.

Staining of human colon shows strong nuclear positivity in glandular cells.

Staining of human cerebral cortex shows moderate nuclear positivity in neurons.

Staining of human colorectal cancer shows moderate nuclear positivity in tumor cells.

Analysis in human colon and liver tissues using NBP1-92365 antibody. Corresponding SATB2 RNA-seq data are presented for the same tissues.

Staining of human rectum shows strong nuclear positivity in glandular cells.

Analysis in human cell line K562.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

SATB2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit SATB2 Antibody - BSA Free (NBP1-92365) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-SATB2 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: KECPLSQSMISSIVNSTYYANVSATKCQEFGRWYKKYKKIKVERVERENLSDYCVLGQRPMHLPNMNQLASLGKTNEQSPHSQIHHSTPIRNQVPALQPIMSPGLLSPQLSPQLV
• Predicted Species: Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SATB2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  SATB2 Protein (NBP1-92365PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for SATB2 Antibody - BSA Free

• DNA-binding protein SATB2
• FLJ32076
• KIAA1034FLJ21474
• MGC119474
• MGC119477
• SATB family member 2
• SATB homeobox 2
• Special AT-rich sequence-binding protein 2

Background

SATB2 binds to DNA, at nuclear matrix- or scaffold-associated regions. Thought to recognize the sugar-phosphate structure of double-stranded DNA. Transcription factor controlling nuclear gene expression, by binding to matrix attachment regions (MARs) of DNA and

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for SATB2 Antibody (NBP1-92365)(1)

Publication using NBP1-92365

• Nodin B, Johannesson H, Wangefjord S et al. Molecular correlates and prognostic significance of SATB1 expression in colorectal cancer. Diagn Pathol 2012-08-30 [PMID: 22935204]

Bioinformatics

• Gene Symbol: SATB2