Sarcalumenin Antibody - BSA Free Summary
| Description |
Novus Biologicals Rabbit Sarcalumenin Antibody - BSA Free (NBP2-88216) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
The immunogen is a synthetic peptide directed towards the C-terminal region of Sarcalumenin. Peptide sequence: QMLMRVYGALFWSLAPLINVTEPPRVYVSSFWPQEYKPDTHQELFLQEEI The peptide sequence for this immunogen was taken from within the described region. |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
SRL |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS, 2% Sucrose |
| Preservative |
0.09% Sodium Azide |
| Concentration |
0.5 mg/ml |
| Purity |
Affinity purified |
Alternate Names for Sarcalumenin Antibody - BSA Free
Background
Sarcalumenin is a 160 kDa acidic calcium binding glycoprotein found to reside at the inner membrane of the sarcoplasmic reticulum in a calcium dependent manner.The gene encoding sarcalumenin also encodes an alternate splice variant, a 53 kDa glycoprotein which co-localizes with sarcalumenin. These two proteins are found in the longitudinal sarcoplasmic reticulum and the nonjunctional membranes of the terminal cisternae. They have been observed to co-localize with calcium-ATPase suggesting that they are involved in calcium transport and sequestration.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Rt
Applications: ELISA, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, WB
Species: Hu
Applications: BA
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: ICC, IHC
Species: Hu
Applications: BA
Species: Mu
Applications: ELISA
Species: Ch, Dr, Fi, Hu, Mar, Mu, Po, Pm, Rb, Rt, Ye, Ze
Applications: ChIP, ChIP, ELISA, Flow, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC, Simple Western, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: ELISA
Species: Hu
Applications: BA
Species: Hu, Mu
Applications: ELISA, ICC/IF, IP, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC, IHC, Neut, WB
Species: Ca, Hu, Mu, Pm, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: WB
Publications for Sarcalumenin Antibody (NBP2-88216) (0)
There are no publications for Sarcalumenin Antibody (NBP2-88216).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Sarcalumenin Antibody (NBP2-88216) (0)
There are no reviews for Sarcalumenin Antibody (NBP2-88216).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Sarcalumenin Antibody (NBP2-88216) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Sarcalumenin Products
Research Areas for Sarcalumenin Antibody (NBP2-88216)
Find related products by research area.
|
Blogs on Sarcalumenin