Sarcalumenin Antibody

Images

 
Western Blot: Sarcalumenin Antibody [NBP2-88216] - WB Suggested Anti-SRL Antibody. Titration: 1.0 ug/ml. Positive Control: MDA-MB-435S Whole Cell

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Sarcalumenin Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Sarcalumenin. Peptide sequence: QMLMRVYGALFWSLAPLINVTEPPRVYVSSFWPQEYKPDTHQELFLQEEI The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
SRL
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Sarcalumenin Antibody

  • sarcalumenin

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-91745
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB600-607
Species: Hu, Rt
Applications: ELISA, IHC, IHC-P, WB
NBP2-57362
Species: Hu
Applications: ICC/IF, WB
202-IL
Species: Hu
Applications: BA
NBP1-92172
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-66861
Species: Hu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
AF6387
Species: Hu
Applications: WB
AF2009
Species: Hu
Applications: ICC, IHC
DY417
Species: Mu
Applications: ELISA
NB500-106
Species: Ch, Dr, Fi, Hu, Mar, Mu, Po, Pm, Rb, Rt, Ye, Ze
Applications: ChIP, ELISA, Flow, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB
AF1638
Species: Hu, Mu, Rt
Applications: ICC, Simple Western, WB
NBP1-89146
Species: Hu
Applications: ICC/IF, IHC, IHC-P
DVE00
Species: Hu
Applications: ELISA
6507-IL/CF
Species: Hu
Applications: BA
H00003845-M01
Species: Hu, Mu
Applications: ELISA, ICC/IF, IP, WB
NBP2-38530
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
DY262
Species: Hu
Applications: ELISA
NB100-56603
Species: Ca, Hu, Mu, Pm, Rt
Applications: IHC, IHC-P, WB
NBP2-88216
Species: Hu
Applications: WB

Publications for Sarcalumenin Antibody (NBP2-88216) (0)

There are no publications for Sarcalumenin Antibody (NBP2-88216).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Sarcalumenin Antibody (NBP2-88216) (0)

There are no reviews for Sarcalumenin Antibody (NBP2-88216). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Sarcalumenin Antibody (NBP2-88216) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Sarcalumenin Products

Bioinformatics Tool for Sarcalumenin Antibody (NBP2-88216)

Discover related pathways, diseases and genes to Sarcalumenin Antibody (NBP2-88216). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Sarcalumenin Antibody (NBP2-88216)

Discover more about diseases related to Sarcalumenin Antibody (NBP2-88216).
 

Pathways for Sarcalumenin Antibody (NBP2-88216)

View related products by pathway.

PTMs for Sarcalumenin Antibody (NBP2-88216)

Learn more about PTMs related to Sarcalumenin Antibody (NBP2-88216).
 

Research Areas for Sarcalumenin Antibody (NBP2-88216)

Find related products by research area.

Blogs on Sarcalumenin

There are no specific blogs for Sarcalumenin, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Sarcalumenin Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SRL