SAMD4A Antibody

Images

 
Western Blot: SAMD4A Antibody [NBP2-13279] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunohistochemistry-Paraffin: SAMD4A Antibody [NBP2-13279] - Staining of human testis shows strong cytoplasmic and nuclear positivity in cells of seminiferus ducts.
Western Blot: SAMD4A Antibody [NBP2-13279] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SAMD4A Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: MWLNHLEDRTSTSFGGQNRGRSDSVDYGQTHYYHQRQNSDDKLNGWQNSR DSGICINASNWQDKSMGCENGHVPLYSSSSVPTTINTIGTSTS
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SAMD4A
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
SAMD4A Protein (NBP2-13279PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SAMD4A Antibody

  • DKFZp434H0350
  • DKFZp686A1532
  • hSmaug1DKFZP434H0350
  • KIAA1053SMAUG1
  • protein Smaug homolog 1
  • SAM domain-containing protein 4A
  • SAMD4
  • Smaug 1
  • smaug homolog
  • Smaug
  • Smaug1
  • SMG
  • SMGA
  • sterile alpha motif domain containing 4
  • sterile alpha motif domain containing 4A
  • Sterile alpha motif domain-containing protein 4A

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-39043
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF4090
Species: Hu
Applications: WB, IHC, IP, Neut
NBP2-22526
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
MAB25031
Species: Hu
Applications: WB, IHC, IP
NBP2-46085
Species: Hu
Applications: WB, IHC
NBP1-87425
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB300-109
Species: Hu, Mu, Rt, Dr, I, Ma
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-FrFl
NB300-605
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-30027
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
MAB4375
Species: Hu, Mu, Rt
Applications: IHC

Publications for SAMD4A Antibody (NBP2-13279) (0)

There are no publications for SAMD4A Antibody (NBP2-13279).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SAMD4A Antibody (NBP2-13279) (0)

There are no reviews for SAMD4A Antibody (NBP2-13279). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SAMD4A Antibody (NBP2-13279) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SAMD4A Products

Bioinformatics Tool for SAMD4A Antibody (NBP2-13279)

Discover related pathways, diseases and genes to SAMD4A Antibody (NBP2-13279). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SAMD4A Antibody (NBP2-13279)

Discover more about diseases related to SAMD4A Antibody (NBP2-13279).
 

Pathways for SAMD4A Antibody (NBP2-13279)

View related products by pathway.

Blogs on SAMD4A

There are no specific blogs for SAMD4A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SAMD4A Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SAMD4A