Recombinant Human SAM68 Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human SAM68 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-381 of Human KHDRBS1 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MQRRDDPAARMSRSSGRSGSMDPSGAHPSVRQTPSRQPPLPHRSRGGGGGSRGGARASPATQPPPLLPPSATGPDATVGGPAPTPLLPPSATASVKMEPENKYLPELMAEKDSLDPSFTHAMQLLTAEIEKIQKGDSKKDDEENYLDLFSHKNMKLKERVLIPVKQYPKFNFVGKILGPQGNTIKRLQEETGAKISVLGKGSMRDKAKEEELRKGGDPKYAHLNMDLHVFIEVFGPPCEAYALMAHAMEEVKKFLVPDMMDDICQEQFLELSYLNGVPEPSRGRGVPVRGRGAAPPPPPVPRGRGVGPPRGALVRGTPVRGAITRGATVTRGVPPPPTVRGAPAPRARTAGIQRIPLPPPPAPETYEEYVRNLNNVPFPST

Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
KHDRBS1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
67.4 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Publications
Read Publication using H00010657-P01.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human SAM68 Protein

  • FLJ34027
  • GAP-associated tyrosine phosphoprotein p62
  • KH domain containing, RNA binding, signal transduction associated 1
  • KH domain-containing, RNA-binding, signal transduction-associated protein 1
  • KHDRBS1
  • p21 Ras GTPase-activating protein-associated p62
  • p62
  • p68
  • SAM68
  • Sam68GAP-associated tyrosine phosphoprotein p62 (Sam68)
  • Src-associated in mitosis 68 kDa protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00008878-M01
Species: Hu, Mu, Rt, Rb
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IP
NB100-2331
Species: Hu, Mu, Rt, Ca, Fi, Pl, Ze
Applications: WB, Simple Western, ELISA, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, SB
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
NB100-82112
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-38556
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB500-249
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
AF6349
Species: Hu, Mu, Rt
Applications: WB
NB100-56583
Species: Hu
Applications: WB, Flow, IHC-P
NBP2-30371
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00000420-B01P
Species: Hu
Applications: WB
NBP2-56841
Species: Hu
Applications: WB, ICC/IF
NB600-607
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-P
NBP1-32822
Species: Hu, Mu, Rt, Av, Ce, Pl
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP, ChIP
NB110-75039
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-88650
Species: Hu
Applications: WB, IHC, IHC-P
H00002968-B01P
Species: Hu
Applications: WB, ICC/IF
H00010657-P01
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for SAM68 Recombinant Protein (H00010657-P01)(1)

Reviews for SAM68 Recombinant Protein (H00010657-P01) (0)

There are no reviews for SAM68 Recombinant Protein (H00010657-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SAM68 Recombinant Protein (H00010657-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for SAM68 Recombinant Protein (H00010657-P01)

Discover related pathways, diseases and genes to SAM68 Recombinant Protein (H00010657-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SAM68 Recombinant Protein (H00010657-P01)

Discover more about diseases related to SAM68 Recombinant Protein (H00010657-P01).
 

Pathways for SAM68 Recombinant Protein (H00010657-P01)

View related products by pathway.

PTMs for SAM68 Recombinant Protein (H00010657-P01)

Learn more about PTMs related to SAM68 Recombinant Protein (H00010657-P01).

Blogs on SAM68

There are no specific blogs for SAM68, but you can read our latest blog posts.

Customers Who Bought This Also Bought

SAM68 Antibody
NBP1-19151
LC3A Antibody
NB100-2331

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human SAM68 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol KHDRBS1
Entrez