S1P3/EDG-3 Antibody (5E3G9)

Western Blot: S1P3/EDG-3 Antibody (5E3G9) [NBP3-15479] - Western blot analysis of extracts of various cell lines, using S1P3/EDG-3 Rabbit mAb (NBP3-15479) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.

• Reactivity: Hu, Mu, Rt
• Applications: WB
• Clone: 5E3G9
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

S1P3/EDG-3 Antibody (5E3G9) Summary

• Description: Novus Biologicals Rabbit S1P3/EDG-3 Antibody (5E3G9) (NBP3-15479) is a recombinant monoclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human S1P3/EDG-3 (Q99500). MATALPPRLQPVRGNETLREHYQYVGKLAGRLKEASEGSTLTTVLFLVICSFIVLENLMVLIAIWKNNKFHNRMYFFIGNLALCDLLAGIAYKVNILMSG
• Source: HEK293
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: S1PR3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:500 - 1:1000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for S1P3/EDG-3 Antibody (5E3G9)

• EDG3
• EDG-3
• EDG3FLJ37523
• Endothelial differentiation G-protein coupled receptor 3
• endothelial differentiation, sphingolipid G-protein-coupled receptor, 3
• FLJ93220
• G protein-coupled receptor, endothelial differentiation gene-3
• LPB3
• MGC71696
• S1P receptor 3
• S1P receptor EDG3
• S1P receptor Edg-3
• S1P3
• S1PR3
• sphingosine 1-phosphate receptor 3
• Sphingosine 1-phosphate receptor Edg-3
• sphingosine-1-phosphate receptor 3

Background

EDG3, a Lysophospholipid/Lysosphingolipid Receptor, binds the vasoconstrictor sphingosine-1-phosphate and activates transcription of serum response element-driven reporter genes. EDG3 may regulate angiogenesis and vascular endothelial cell functions. EDG3 has been reported in all tissues, with highest levels in heart, placenta, kidney, and liver. ESTs have been isolated from placenta and germ cell tumor libraries.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: S1PR3