S100A8 Recombinant Protein Antigen

Images

 
There are currently no images for S100A8 Recombinant Protein Antigen (NBP1-90314PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

S100A8 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human S100A8.

Source: E. coli

Amino Acid Sequence: LTELEKALNSIIDVYHKYSLIKGNFHAVYRDDLKKLLETECPQYIRKKGADVWFKELDINTDGAVNFQEFLILVIKM

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
S100A8
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-90314.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for S100A8 Recombinant Protein Antigen

  • 60B8AG
  • CAGACP-10
  • Calgranulin A
  • Calgranulin-A
  • Calprotectin L1L subunit
  • CFAG
  • CFAGL1Ag
  • CGLA
  • Cystic fibrosis antigen
  • Leukocyte L1 complex light chain
  • MA387
  • MIF
  • Migration inhibitory factor-related protein 8
  • MRP8
  • MRP-8
  • MRP8S100 calcium binding protein A8 (calgranulin A)
  • NIF
  • P8
  • protein S100-A8
  • S100 calcium binding protein A8
  • S100 calcium-binding protein A8 (calgranulin A)
  • S100 calcium-binding protein A8
  • S100A8
  • Urinary stone protein band A

Background

MRP8 is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein may function in the inhibition of casein kinase and as a cytokine. Altered expression of this protein is associated with the disease cystic fibrosis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF2065
Species: Mu
Applications: ICC, IHC, Simple Western, WB
M6000B
Species: Mu
Applications: ELISA
NBP1-32870
Species: Ch, Hu
Applications: IHC, IHC-P, IP, KD, WB
NBP1-87103
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NBP1-87102
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
AF1052
Species: Hu
Applications: CyTOF-ready, Flow, IHC, Simple Western, WB
NBP1-71702
Species: Ch, Hu, Mu
Applications: ChIP, ChIP, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
DY417
Species: Mu
Applications: ELISA
MAB208
Species: Hu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), ICC, ICFlow, Neut, Simple Western, WB
DY1707
Species: Hu
Applications: ELISA
NB100-56566
Species: Bv, Hu, Ma, Mu, Po, Rt
Applications: B/N, ChIP, CyTOF-ready, DB, Dual ISH-IHC, ELISA(Cap), ELISA, Flow-CS, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, KD, KO, PAGE, Simple Western, WB
NB200-106
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP2-44520
Species: Ca(-), Hu, Rt(-)
Applications: Flow-IC, Flow, ICC/IF, IF, IHC, IHC-P, MI, WB
NB400-156
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Dual ISH-IHC, ELISA, Flow, ICC/IF, IHC, IP, Simple Western, WB
DCP00
Species: Hu
Applications: ELISA
NBP2-30949
Species: Hu
Applications: IHC, IHC-P
NBP1-97512
Species: Mu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP1-81293
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP1-62583
Species: Hu
Applications: WB

Publications for S100A8 Recombinant Protein Antigen (NBP1-90314PEP) (0)

There are no publications for S100A8 Recombinant Protein Antigen (NBP1-90314PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for S100A8 Recombinant Protein Antigen (NBP1-90314PEP) (0)

There are no reviews for S100A8 Recombinant Protein Antigen (NBP1-90314PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for S100A8 Recombinant Protein Antigen (NBP1-90314PEP). (Showing 1 - 2 of 2 FAQ).

  1. Have any of your MRP8 antibodies been tested for use in neutralization, or blocking assays, on human samples?
    • Unfortunately at this time we have not tested, or received customer feedback on our MMP8 antibodies for use in blocking or neutralizing assays. If you were planning on testing any of our MMP8 antibodies for neutralizing or blocking capabilities, we would recommend our Innovator’s Reward Program. Under the terms of this program we would be happy to provide a credit for a free vial in exchange for new data on this previously untested or reported application. Please submit this data in the form of an online review. Additional Innovators Reward Program information can be found using this link.
  2. We would like to stain paraffin embedded human intestinal tissue for Calprotectin. One question will be which cells express the majority of Calprotectin - invading neutrophils vs epithelium for example. The antibody list you provide is quite extensive. Which antibody would you recommend for our purpose? Which tissue would you recommend as positive control.
    • Nine of our antibodies to Calprotectin have been validated for IHC-P with human tissue, and you can see all of these products. A number of our IHC images were generated using human spleen samples, and as such this may be a good choice of a positive control tissue. We do sell a human spleen slide product, which is suitable for IHC-P. Unfortunately I do not have an in-depth knowledge of Calprotectin, however the image shown for our antibody with catalogue number NBP1-02826 demonstrates clear staining of neutrophils. The following paper also suggests that the protein is abundant in neutrophils: PMID 11435495.

Additional S100A8 Products

Research Areas for S100A8 Recombinant Protein Antigen (NBP1-90314PEP)

Find related products by research area.

Blogs on S100A8

There are no specific blogs for S100A8, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our S100A8 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol S100A8