S100A7A Antibody

Images

 
Western Blot: S100A7A Antibody [NBP3-09472] - Western blot analysis of S100A7A in Fetal Heart as a positive control. Antibody dilution at 1.0 ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

S100A7A Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the middle region of Human S100A7A (NP_789793). Peptide sequence CDKKGIHYLATVFEKKDKNEDKKIDFSEFLSLLGDIAADYHKQSHGAAPC
Clonality
Polyclonal
Host
Rabbit
Gene
S100A7A
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml
Theoretical MW
11 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS buffer, 2% sucrose.
Preservative
0.09% Sodium Azide
Purity
Affinity purified

Alternate Names for S100A7A Antibody

  • protein S100-A7A
  • NICE-2
  • S100 calcium binding protein A7A
  • S100A15
  • S100A7f
  • S100A7L1

Background

S100A7A may be involved in epidermal differentiation and inflammation and might therefore be important for thepathogenesis of psoriasis and other diseases

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56559
Species: Hu, Mu
Applications: EM, Flow-IC, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB
NBP2-45267
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP1-87103
Species: Hu, Mu
Applications: IHC, IHC-P, WB
782-IL/CF
Species: Hu
Applications: BA
NB120-495
Species: Dr, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
NB100-56566
Species: Bv, Hu, Ma, Mu, Po, Rt
Applications: B/N, ChIP, CyTOF-ready, DB, Dual ISH-IHC, ELISA(Cap), ELISA, Flow-CS, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, KD, KO, PAGE, WB
NBP2-42913
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
210-TA
Species: Hu
Applications: BA
DRG00
Species: Hu
Applications: ELISA
DY421
Species: Mu
Applications: ELISA
MAB15041
Species: Hu
Applications: CyTOF-ready, IHC, ICFlow, WB
NBP1-31647
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
AF5415
Species: Hu
Applications: ICC, IHC, Simple Western, WB
AF2065
Species: Mu
Applications: ICC, IHC, Simple Western, WB
AF1052
Species: Hu
Applications: CyTOF-ready, Flow, IHC, Simple Western, WB
NBP1-90310
Species: Hu
Applications: IHC, IHC-P, WB
AF2957
Species: Hu
Applications: IHC, KO, WB
NBP2-79899
Species: Hu
Applications: CyTOF-ready, Flow, ICC/IF, IHC, IHC-P, PA, WB
NBP1-54679
Species: Hu
Applications: IHC, IHC-P, WB
NBP3-09472
Species: Hu
Applications: WB

Publications for S100A7A Antibody (NBP3-09472) (0)

There are no publications for S100A7A Antibody (NBP3-09472).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for S100A7A Antibody (NBP3-09472) (0)

There are no reviews for S100A7A Antibody (NBP3-09472). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for S100A7A Antibody (NBP3-09472) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional S100A7A Products

Bioinformatics Tool for S100A7A Antibody (NBP3-09472)

Discover related pathways, diseases and genes to S100A7A Antibody (NBP3-09472). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for S100A7A Antibody (NBP3-09472)

Discover more about diseases related to S100A7A Antibody (NBP3-09472).
 

Pathways for S100A7A Antibody (NBP3-09472)

View related products by pathway.

Research Areas for S100A7A Antibody (NBP3-09472)

Find related products by research area.

Blogs on S100A7A

There are no specific blogs for S100A7A, but you can read our latest blog posts.
Download our IHC Handbook

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our S100A7A Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol S100A7A