S100A5 Antibody (5E1.)

Images

 
Immunohistochemistry-Paraffin: S100A5 Antibody (5E1) [H00006276-M03] - Analysis of monoclonal antibody to S100A5 on formalin-fixed paraffin-embedded human kidney. Antibody concentration 1.5 ug/ml
Sandwich ELISA: S100A5 Antibody (5E1) [H00006276-M03] - Detection limit for recombinant GST tagged S100A5 is 3 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, IHC-P
Clone
5E1.
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

S100A5 Antibody (5E1.) Summary

Immunogen
S100A5 (NP_002953, 1 a.a. - 90 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MPAAWILWAHSHSELHTVMETPLEKALTTMVTTFHKYSGREGSKLTLSRKELKELIKKELCLGEMKESSIDDLMKSLDKNSDQEIDFKEY
Specificity
S100A5 (5E1)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
S100A5
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunohistochemistry-Paraffin
Application Notes
Antibody reactivity against recombinant protein for WB. It has been used for IHC-P and ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for S100A5 Antibody (5E1.)

  • Protein S-100D
  • S100 calcium binding protein A5
  • S100 calcium-binding protein A5S100Dprotein S100-A5

Background

The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein has a Ca2+ affinity 20- to 100-fold higher than the other S100 proteins studied under identical conditions. This protein also binds Zn2+ and Cu2+, and Cu2+ strongly which impairs the binding of Ca2+. This protein is expressed in very restricted regions of the adult brain.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-45224
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-29403
Species: Hu, Mu, Rt, Bv
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-89388
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-54679
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-36431
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF4870
Species: Hu
Applications: WB, ICC
AF2065
Species: Mu
Applications: WB, Simple Western, ICC
NBP1-86039
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF3059
Species: Mu
Applications: WB, Simple Western, ICC
AF1052
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready
MAB2957
Species: Hu
Applications: WB, ICC, KO
AF2377
Species: Mu
Applications: WB, Simple Western, IHC
AF4874
Species: Hu
Applications: WB, IHC
NB100-56559
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
NBP1-90000
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-03950
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB300-538
Species: Hu, Mu, Rt, Rb
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P

Publications for S100A5 Antibody (H00006276-M03) (0)

There are no publications for S100A5 Antibody (H00006276-M03).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for S100A5 Antibody (H00006276-M03) (0)

There are no reviews for S100A5 Antibody (H00006276-M03). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for S100A5 Antibody (H00006276-M03) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional S100A5 Products

Bioinformatics Tool for S100A5 Antibody (H00006276-M03)

Discover related pathways, diseases and genes to S100A5 Antibody (H00006276-M03). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for S100A5 Antibody (H00006276-M03)

Discover more about diseases related to S100A5 Antibody (H00006276-M03).
 

Pathways for S100A5 Antibody (H00006276-M03)

View related products by pathway.

Blogs on S100A5

There are no specific blogs for S100A5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our S100A5 Antibody (5E1.) and receive a gift card or discount.

Bioinformatics

Gene Symbol S100A5
Entrez
OMIM
Uniprot