S-arrestin Antibody

Images

 
Immunohistochemistry-Paraffin: S-arrestin Antibody [NBP2-55126] - Staining of human retina shows strong positivity in rod segments

Product Details

Summary
Reactivity Hu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

S-arrestin Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: EPNHVIFKKISRDKSVTIYLGNRDYIDHVSQVQPVDGVVLVDPDLVKGKKVYVTLTCAFRYGQEDIDVIGLTFRRDLYFSRVQVYPPVGAASTPTKLQESLLKKLGSNTYPFLLTFPDYLPCSVMLQPAPQDSGKS
Specificity
Specificity of human S-arrestin antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Rat (90%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SAG
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:2500 - 1:5000
  • Immunohistochemistry-Paraffin 1:2500 - 1:5000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
S-arrestin Recombinant Protein Antigen (NBP2-55126PEP)

Reactivity Notes

Mouse 89%

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for S-arrestin Antibody

  • arrestin 1
  • RP47,48 kDa protein
  • S-antigen; retina and pineal gland (arrestin)
  • S-arrestin
  • visual arrestin

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-85594
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB59151
Species: Mu
Applications: WB
NBP2-44179
Species: Mu
Applications: WB, ELISA
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP2-25159
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF, IHC
NBP1-86614
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-55298
Species: Hu
Applications: WB, IHC, IHC-P
44260002
Species: Hu
Applications: WB, ELISA
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-03062
Species: Hu, Rt, Ca, Pm
Applications: WB, Flow, IHC, IHC-P
NBP1-57016
Species: Hu
Applications: WB
NBP2-75643
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-31363
Species: Hu
Applications: WB, ICC/IF
NBP1-81988
Species: Hu
Applications: IHC, IHC-P
NBP2-21037
Species: Hu
Applications: WB, IHC, IHC-P
AF743
Species: Mu
Applications: WB, Flow, CyTOF-ready
NBP2-55126
Species: Hu, Rt
Applications: IHC, IHC-P

Publications for S-arrestin Antibody (NBP2-55126) (0)

There are no publications for S-arrestin Antibody (NBP2-55126).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for S-arrestin Antibody (NBP2-55126) (0)

There are no reviews for S-arrestin Antibody (NBP2-55126). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for S-arrestin Antibody (NBP2-55126) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for S-arrestin Antibody (NBP2-55126)

Discover related pathways, diseases and genes to S-arrestin Antibody (NBP2-55126). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for S-arrestin Antibody (NBP2-55126)

Discover more about diseases related to S-arrestin Antibody (NBP2-55126).
 

Pathways for S-arrestin Antibody (NBP2-55126)

View related products by pathway.

PTMs for S-arrestin Antibody (NBP2-55126)

Learn more about PTMs related to S-arrestin Antibody (NBP2-55126).
 

Research Areas for S-arrestin Antibody (NBP2-55126)

Find related products by research area.

Blogs on S-arrestin.

"Freeze!" - Arrestin Antibodies Used in New Serotonin Syndrome Study
The beta-arrestin family regulate receptor binding of G-proteins, a group of seven transmembrane receptor proteins which includes the adrenergic, dopamine and serotonin receptors. Recently, arrestin antibodies were used in a study into Serotonin Syndr...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our S-arrestin Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SAG