Ryk Antibody - BSA Free Summary
| Immunogen |
This antibody was developed against a recombinant protein corresponding to amino acids: LWELMTLGQTPYVDIDPFEMAAYLKDGYRIAQPINCPDELFAVMACCWALDPEERPKFQQLVQCLTEFHAALG |
| Predicted Species |
Mouse (100%), Rat (100%). Backed by our 100% Guarantee. |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
RYK |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
|
| Application Notes |
Recommended conditions: Fixation/Permeabilization: PFA/Triton X-100 |
| Control Peptide |
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for Ryk Antibody - BSA Free
Background
RYK (Receptor like Tyrosine kinase 1) is in the Tyrosine family of receptor kinases. It is found in the plasma membrane of heart, prostate and kidney cells. RYK contains 604 amino acids and it contains one WIF domain. It functions as a potential growth factor receptor protein tyrosine kinase. RYK are divergent from those of other classic receptor tyrosine kinases. It is an orphan receptor that contains a catalytically inactive tyrosine kinase related domain. RYK is expressed in nestin positive progenitor cells and neurons, and in a certain population of oligodendrocytes, O2A progenitor cells, and type 2 astrocytes in developing CNS.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Mu
Applications: IHC, WB
Species: Hu
Applications: WB
Species: Hu, Rt
Applications: ICC/IF, IHC-P, WB
Species: Hu
Applications: Simple Western, WB
Species: Hu, Mu
Applications: BA
Species: Hu, Mu, Rt
Applications: ChIP, CyTOF-ready, ICC, IHC, ICFlow, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ChIP-EXO-SEQ, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: CyTOF-ready, Flow, ICC
Species: Mu
Applications: BA
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: BA, BA
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: Simple Western, WB
Species: Mu
Applications: IHC, WB
Species: Mu
Applications: IHC, WB
Species: Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, Flow, ICC/IF, MiAr, Simple Western, WB
Species: Hu
Applications: Block, IHC, Simple Western, WB
Publications for Ryk Antibody (NBP2-69008) (0)
There are no publications for Ryk Antibody (NBP2-69008).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Ryk Antibody (NBP2-69008) (0)
There are no reviews for Ryk Antibody (NBP2-69008).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Ryk Antibody (NBP2-69008) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Ryk Products
Research Areas for Ryk Antibody (NBP2-69008)
Find related products by research area.
|
Blogs on Ryk