RXR beta/NR2B2 Recombinant Protein Antigen

Images

 
There are currently no images for RXR beta/NR2B2 Recombinant Protein Antigen (NBP3-25117PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

RXR beta/NR2B2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human RXR beta/NR2B2

Source: E.coli

Amino Acid Sequence: MSWAARPPFLPQRHAAGQCGPVGVRKEMHCGVASRWRRRRPWLDPA

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Protein/Peptide Type
Recombinant Protein Antigen
Gene
RXRB
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-25117It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for RXR beta/NR2B2 Recombinant Protein Antigen

  • DAUDI6
  • H-2RIIBP
  • MHC class I promoter binding protein
  • NR2B2
  • NR2B2MGC1831
  • Nuclear receptor subfamily 2 group B member 2
  • RCoR-1
  • retinoic acid receptor RXR-beta
  • Retinoid X receptor beta
  • retinoid X receptor, beta
  • RXR beta
  • RXRB

Background

Retinoid X receptors (RXRs) are members of the steroid/thyroid hormone receptor superfamily of nuclear receptor proteins which exert their effects by binding to specific DNA response elements, thus regulating gene expression in target cells. The RXR subfamily consists of at least three similar genes, RXR alpha, RXR beta and RXR gamma, all of which control transcription of target genes mediated by retinoids. RXR beta controls expression of many genes that respond to hormones and vitamins, including thyroid hormone, estrogen, retinoids and vitamin D. RXR beta controls a wide array of genes because of its ability to heterodimerize with other hormone receptors including the thyroid hormone receptor (THR), vitamin D receptor (VDR) and retinoic acid receptor (RAR).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-75653
Species: Hu, Mu, Rt
Applications: ICC/IF,  IHC-P, IP, WB
NBP3-35275
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP2-45516
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
PP-H3210-00
Species: Hu
Applications: DirELISA, IP, WB
NB300-537
Species: Bv, Hu, Mu, Rb, Rt
Applications: ChIP, Flow, GS, ICC/IF, IHC,  IHC-P, IP, KD, Simple Western, WB
NB120-6405
Species: Rt
Applications: B/N, CyTOF-ready, EM, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP
NBP2-43728
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
NBP3-46820
Species: Hu
Applications: ELISA, IHC, WB
NBP1-85309
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-13893
Species: Hu
Applications: IHC,  IHC-P, WB
NB100-1028
Species: Ca, Eq, Fe, Hu, Mu, Rt
Applications: Dual ISH-IHC, ICC/IF, IHC-FrFl, IHC-WhMt, IHC, IHC-Fr,  IHC-P, KO, PEP-ELISA, WB
NBP2-37370
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, IHC,  IHC-P, WB
NBP1-30475
Species: Hu, Mu
Applications: IHC,  IHC-P, IP, WB
NBP3-38079
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP1-84309
Species: Hu
Applications: IHC,  IHC-P, WB
NBP1-76504
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP1-86968
Species: Hu
Applications: IHC,  IHC-P
NB200-310
Species: Hu, Pm, Mu, Rt
Applications: ChIP, IP, WB
NBP3-25117PEP
Species: Hu
Applications: AC

Publications for RXR beta/NR2B2 Recombinant Protein Antigen (NBP3-25117PEP) (0)

There are no publications for RXR beta/NR2B2 Recombinant Protein Antigen (NBP3-25117PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RXR beta/NR2B2 Recombinant Protein Antigen (NBP3-25117PEP) (0)

There are no reviews for RXR beta/NR2B2 Recombinant Protein Antigen (NBP3-25117PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for RXR beta/NR2B2 Recombinant Protein Antigen (NBP3-25117PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional RXR beta/NR2B2 Products

Research Areas for RXR beta/NR2B2 Recombinant Protein Antigen (NBP3-25117PEP)

Find related products by research area.

Blogs on RXR beta/NR2B2

There are no specific blogs for RXR beta/NR2B2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our RXR beta/NR2B2 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol RXRB