RXR beta/NR2B2 Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

RXR beta/NR2B2 Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human RXR beta/NR2B2
  
  

  Source: E.coli

  Amino Acid Sequence: MSWAARPPFLPQRHAAGQCGPVGVRKEMHCGVASRWRRRRPWLDPA

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: RXRB
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10-100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-25117It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for RXR beta/NR2B2 Recombinant Protein Antigen

• DAUDI6
• H-2RIIBP
• MHC class I promoter binding protein
• NR2B2
• NR2B2MGC1831
• Nuclear receptor subfamily 2 group B member 2
• RCoR-1
• retinoic acid receptor RXR-beta
• Retinoid X receptor beta
• retinoid X receptor, beta
• RXR beta
• RXRB

Background

Retinoid X receptors (RXRs) are members of the steroid/thyroid hormone receptor superfamily of nuclear receptor proteins which exert their effects by binding to specific DNA response elements, thus regulating gene expression in target cells. The RXR subfamily consists of at least three similar genes, RXR alpha, RXR beta and RXR gamma, all of which control transcription of target genes mediated by retinoids. RXR beta controls expression of many genes that respond to hormones and vitamins, including thyroid hormone, estrogen, retinoids and vitamin D. RXR beta controls a wide array of genes because of its ability to heterodimerize with other hormone receptors including the thyroid hormone receptor (THR), vitamin D receptor (VDR) and retinoic acid receptor (RAR).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: RXRB