RXR beta/NR2B2 Antibody (2E6.)

Images

 
Sandwich ELISA: RXR beta/NR2B2 Antibody (2E6) [H00006257-M10] - Detection limit for recombinant GST tagged RXRB is 1 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
2E6.
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

RXR beta/NR2B2 Antibody (2E6.) Summary

Immunogen
RXRB (AAH01167.1 161 a.a. - 260 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. QINSTVSLPGGGSGPPEDVKPPVLGVRGLHCPPPPGGPGAGKRLCAICGDRSSGKHYGVYSCEGCKGFFKRTIRKDLTYSCRDNKDCTVDKRQRNRCQYC
Specificity
RXRB - retinoid X receptor, beta (2E6)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
RXRB
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for RXR beta/NR2B2 Antibody (2E6.)

  • DAUDI6
  • H-2RIIBP
  • MHC class I promoter binding protein
  • NR2B2
  • NR2B2MGC1831
  • Nuclear receptor subfamily 2 group B member 2
  • RCoR-1
  • retinoic acid receptor RXR-beta
  • Retinoid X receptor beta
  • retinoid X receptor, beta
  • RXR beta
  • RXRB

Background

This gene encodes a member of the retinoid X receptor (RXR) family of nuclear receptors which are involved in mediating the effects of retinoic acid (RA). This receptor forms homodimers with the retinoic acid, thyroid hormone, and vitamin D receptors, increasing both DNA binding and transcriptional function on their respective response elements. The gene lies within the major histocompatibility complex (MHC) class II region on chromosome 6. An alternatively spliced transcript variant has been described, but its full length sequence has not been determined. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

PP-K8508-00
Species: Hu
Applications: WB, IHC, IP, GS
NBP2-53380
Species: Hu
Applications: ICC/IF, IHC-P, PAGE
NB200-322
Species: Hu, Mu, Rt
Applications: WB, IHC-Fr
NB200-321
Species: Hu, Rt
Applications: WB
NB300-537
Species: Hu, Mu, Rt, Bv, Rb
Applications: WB, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP
NB120-6405
Species: Rt
Applications: B/N, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-43728
Species: Hu
Applications: WB, ICC/IF
NBP1-58922
Species: Hu
Applications: WB
NBP1-85309
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-13893
Species: Hu
Applications: WB, IHC, IHC-P
NB100-1028
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA, ICC
NBP2-37370
Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready
NBP1-30475
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP, PLA
NBP2-13513
Species: Hu
Applications: WB, AG, ICC/IF, IHC, IHC-P
NBP1-84309
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-76504
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC
NBP1-59071
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB200-310
Species: Hu, Mu, Rt, Mk
Applications: WB, ChIP, IP, IF
H00006257-M10
Species: Hu
Applications: WB, ELISA

Publications for RXR beta/NR2B2 Antibody (H00006257-M10) (0)

There are no publications for RXR beta/NR2B2 Antibody (H00006257-M10).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RXR beta/NR2B2 Antibody (H00006257-M10) (0)

There are no reviews for RXR beta/NR2B2 Antibody (H00006257-M10). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RXR beta/NR2B2 Antibody (H00006257-M10) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RXR beta/NR2B2 Products

Bioinformatics Tool for RXR beta/NR2B2 Antibody (H00006257-M10)

Discover related pathways, diseases and genes to RXR beta/NR2B2 Antibody (H00006257-M10). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RXR beta/NR2B2 Antibody (H00006257-M10)

Discover more about diseases related to RXR beta/NR2B2 Antibody (H00006257-M10).
 

Pathways for RXR beta/NR2B2 Antibody (H00006257-M10)

View related products by pathway.

PTMs for RXR beta/NR2B2 Antibody (H00006257-M10)

Learn more about PTMs related to RXR beta/NR2B2 Antibody (H00006257-M10).
 

Research Areas for RXR beta/NR2B2 Antibody (H00006257-M10)

Find related products by research area.

Blogs on RXR beta/NR2B2

There are no specific blogs for RXR beta/NR2B2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RXR beta/NR2B2 Antibody (2E6.) and receive a gift card or discount.

Bioinformatics

Gene Symbol RXRB
Entrez
Uniprot