RS1 Antibody - BSA Free

Immunohistochemistry-Paraffin: RS1 Antibody [NBP2-56487] - Staining of human tonsil shows no positivity in lymphoid cells as expected.

Immunohistochemistry-Paraffin: RS1 Antibody [NBP2-56487] - Staining of human eye, retina shows moderate positivity in photoreceptor cells and nerve fibers.

Immunohistochemistry-Paraffin: RS1 Antibody [NBP2-56487] - Staining of human liver shows no postivity in hepatocytes expected.

Immunohistochemistry-Paraffin: RS1 Antibody [NBP2-56487] - Staining of human skeletal muscle shows no positivity in myocytes as expected.

• Reactivity: Hu, Mu, Rt
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

RS1 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: SSWTANKARLNSQGFGCAWLSKFQDSSQWLQIDLKEIKVISGILTQGRCDIDEWMTKYSVQYRTDE
• Predicted Species: Mouse (97%), Rat (98%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RS1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  RS1 Recombinant Protein Antigen (NBP2-56487PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for RS1 Antibody - BSA Free

• retinoschisin 1
• retinoschisis (X-linked, juvenile) 1
• RS
• XL
• X-linked juvenile retinoschisis protein
• XLRS1retinoschisin

Background

RS1 encodes an extracellular protein that plays a crucial role in the cellular organization of the retina. The encoded protein is assembled and secreted from photoreceptors and bipolar cells as a homo-oligomeric protein complex. Mutations in this gene are responsible for X-linked retinoschisis, a common, early-onset macular degeneration in males that results in a splitting of the inner layers of the retina and severe loss in vision. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: RS1