RSC1A1 Antibody (NBP1-80811)

Images

 
Immunocytochemistry/ Immunofluorescence: RSC1A1 Antibody [NBP1-80811] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: RSC1A1 Antibody [NBP1-80811] - Staining of human hippocampus shows strong cytoplasmic positivity in neuronal cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RSC1A1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:LEKSAERSTQGLKFHLHTRQEASLSVTSTRMHEPQMFLGEKDWHPENQNLSQVSDPQQHEEPGNEQYEVAQQKASHDQEYLCNIGDLELPEERQQNQHKI
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RSC1A1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin HIER pH6 retrieval is recommended. IF fixation permeabilization: PFA/Triton X-100.
Control Peptide
RSC1A1 Protein (NBP1-80811PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for RSC1A1 Antibody

  • hRS1
  • regulatory solute carrier protein family 1 member 1
  • regulatory solute carrier protein, family 1, member 1
  • RS1Transporter regulator RS1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-20338
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00003757-R07
Species: Hu
NBP2-60655
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-32433
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24449
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow
NB400-118
Species: Hu, Mu(-)
Applications: WB, ELISA, ICC/IF
AF5745
Species: Hu
Applications: WB, IHC
NBP2-20324
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF6387
Species: Hu
Applications: WB
NB100-65214
Species: Hu, Mu, Rt, Ma
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NB110-41404
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC
NBP1-78989
Species: Mu, Rt
Applications: WB (-), IHC
H00000265-M03
Species: Hu
Applications: WB, ELISA
NB100-355
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Xp
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready
NBP2-34294
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC-P
NBP1-84168
Species: Hu
Applications: IHC, IHC-P
NBP1-89417
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NBP1-80811
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for RSC1A1 Antibody (NBP1-80811) (0)

There are no publications for RSC1A1 Antibody (NBP1-80811).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RSC1A1 Antibody (NBP1-80811) (0)

There are no reviews for RSC1A1 Antibody (NBP1-80811). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for RSC1A1 Antibody (NBP1-80811) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RSC1A1 Products

Related Products by Gene

Bioinformatics Tool for RSC1A1 Antibody (NBP1-80811)

Discover related pathways, diseases and genes to RSC1A1 Antibody (NBP1-80811). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RSC1A1 Antibody (NBP1-80811)

Discover more about diseases related to RSC1A1 Antibody (NBP1-80811).
 

Pathways for RSC1A1 Antibody (NBP1-80811)

View related products by pathway.

PTMs for RSC1A1 Antibody (NBP1-80811)

Learn more about PTMs related to RSC1A1 Antibody (NBP1-80811).

Blogs on RSC1A1

There are no specific blogs for RSC1A1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RSC1A1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RSC1A1